1NIS,1C96


Conserved Protein Domain Family
AcnA_Mitochon_Swivel

?
cd01578: AcnA_Mitochon_Swivel 
Click on image for an interactive view with Cn3D
Mitochondrial aconitase A swivel domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.
Statistics
?
PSSM-Id: 238810
View PSSM: cd01578
Aligned: 13 rows
Threshold Bit Score: 307.088
Threshold Setting Gi: 46098715
Created: 16-Jul-2004
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
substrate
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:substrate binding site [chemical binding site]
Evidence:
  • Structure:1NIS binds nitrocitrate; contacts at 3.5A
    View structure with Cn3D
  • Comment:These residues participate in the active site of the catalytic domain.
  • Citation:PMID 1547214

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                           #                                                           
1NIS        560 KVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINSENRKANSVRNAVTQEFGPVPDTARYYKQHGIRWVVIGDENYG 639 cow
1C96_A      559 KVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENRKANSVRNAVTQEFGPVPDTARYYKQHGIRWVVIGDENYG 638 cow
P19414      584 KAVGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENKKANCVKNVYTGEYKGVPDTARDYRDQGIKWVVIGDENFG 663 baker's yeast
P49609      585 KARGKCTTDHISMAGPWLKFRGHLDNISNNMLIGAVNDENGEINNVKNAVTGEYGTVPDTARAYKAEGVKWVVIGDENYG 664 Gracilaria gracilis
O13966      582 KAKGKCTTDHISAAGPWLKYRGHLQNISNNYMIGAINAENGEANKLKDQLTGEYKTVPNVAIDYRDHGIRWVTLGEQNFG 661 fission yeast
NP_524708   595 KVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGATNYENNEMNNIKNQRNGSWGGVPDVARDYKANGIKWVAVGDENYG 674 fruit fly
P34455      581 KVTGKCTTDHISAAGPWLKYRGHLDNISNNLFLTAINADNGEMNKVKNQVTGEYGAVPATARKYKADGVRWVAIGDENYG 660 nematode
ZP_00116914 561 KAKGKCTTDHISMAGPWLKYRGHLDNISNNMLIGAVNFFNDKTDDVKNQLTGTYGPVPATQRAYKAQGIGSIVVGDENYG 640 Cytophaga hutchi...
NP_714871   561 KAKGKCTTDHISMAGPWLKYRGHLDNISNNLLIGAVNSFNDKTNEVKNQLSGAYEPVPQTARAYKAKGIGSIVVGDENYG 640 Leptospira inter...
XP_331142   591 KAQGKTTTDHISMAGPWLKYRGHLDNISNNMLIGAINAANGEANKVQNFTTGEWDAVPAVARDYKAKNIPWVVIGDWNYG 670 Neurospora crassa
NP_989519   589 KVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNALTQEFGPVPDTARYYKKMGVKWAVIGDENYG 668 chicken
EAK83948    601 KAQGKCTTDHISAGGPWLKYRGHLENISNNCLIGAINAANGKANEIQNVFTGEWGPVPATAIQYREAGKPWVVIGDENYG 680 Ustilago maydis 521
AAH68910    589 KVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENNKANSAKNCVNQEYGSVPDTARYYKAHGIKWVVIGDENYG 668 African clawed frog
Feature 1         ###                                                                
1NIS        640 EGSSREHRALEPRFLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFAPG 708 cow
1C96_A      639 EGASREHSALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFAPG 707 cow
P19414      664 EGSSREHAALEPRFLGGFAIITKSFARIHETNLKKQGLLPLNFKNPADYDKINPDDRIDILGLAELAPG 732 baker's yeast
P49609      665 EGSSREHAALEPRHLGGVAVIVKSFARIHETNLKKQGMLPLTFNNPADYDKIDSSDKVSLVGLKNLTPG 733 Gracilaria gracilis
O13966      662 EGSSREHAALEPRYLGGAAVITKSFARIHETNLKKQGLLPLTFADPAAYDKISPFDTVDIDGLTTFAPG 730 fission yeast
NP_524708   675 EGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAPG 743 fruit fly
P34455      661 EGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGMLPLTFANPADYDKIDPSDNVSIVGLSSFAPG 729 nematode
ZP_00116914 641 EGSSREHAAMEPRHLGVRAVLVKSFARIHETNLKKQGMLGLTFANKDDYNKIQEDDSIDILGLTTFAPN 709 Cytophaga hutchinsonii
NP_714871   641 EGSSREHAAMEPRHLGVRAVIVKSFARIHETNLKKQGMLALTFADKSDYDKIQEEDSIDILGLTSFQEG 709 Leptospira interrogans sero...
XP_331142   671 EGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPADYDKISPEDKVDILCTELAVGK 739 Neurospora crassa
NP_989519   669 EGSSREHAALEPRHLGGRVIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLSIVGLADFAPG 737 chicken
EAK83948    681 EGSSREHAALEPRFLGGCAVIARSFARIHQTNLRKQGMLAFEFADPADYDKVRPDDLVDILGVTELAPG 749 Ustilago maydis 521
AAH68910    669 EGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFSDPADYDRIHPEDKITLAGLKDLAPG 737 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap