4Q3F


Conserved Protein Domain Family
MIF

?
pfam01187: MIF 
Click on image for an interactive view with Cn3D
Macrophage migration inhibitory factor (MIF)
Statistics
?
PSSM-Id: 250427
View PSSM: pfam01187
Aligned: 6 rows
Threshold Bit Score: 181.094
Threshold Setting Gi: 2833295
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4Q3F_C   1 PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVgTAEDNRSHSAHF 80  human
Q18785   2 PMVRVATNLPNEKVPVDFEIRLTDLLARSMGKPRERIAVEIAAGARLVHGATHDPVTVISIKSIGAV-SAEDNIRNTAAI 80  Caenorhabditis elegans
P80254   2 PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVgTAEQNRSHSSSF 81  Norway rat
P91850   2 PYFTIDTNIPQNSISSAFLKKASNVVAKALGKPESYVSIHVNGGQAMVFGGSEDPCAVCVLKSIGCV-GPKVNNSHAEKL 80  Brugia malayi
P80177   2 PMFVVNTNVPRASVPDGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFGGSSEPCALCSLHSIGKI-GGAQNRSYSKLL 80  cattle
Q02960   2 PMFTIHTNVCKDAVPDSLLGELTQQLAKATGKPAQYIAVHIVPDQMMSFGGSTDPCALCSLYSIGKI-GGQQNKTYTKLL 80  chicken
4Q3F_C  81 FEFLTKELALGQDRILIRFFPLESWQIGKIGTVMT 115 human
Q18785  81 TEFCGKELGLPKDKVVITFHDLPPATVGFNGTTVA 115 Caenorhabditis elegans
P80254  82 FKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMT 116 Norway rat
P91850  81 YKLLADELKIPKNRCYIEFVDIEASSMAFNGSTFG 115 Brugia malayi
P80177  81 CGLLTERLRISPDRIYINFCDMNAANVGWNGSTFA 115 cattle
Q02960  81 CDMIAKHLHVSADRVYINYFDINAANVGWNGSTFA 115 chicken
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap