Conserved Protein Domain Family
oat

?
TIGR00805: oat 
sodium-independent organic anion transporter
The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.
Statistics
?
PSSM-Id: 273279
View PSSM: TIGR00805
Aligned: 8 rows
Threshold Bit Score: 769.281
Threshold Setting Gi: 1065483
Created: 7-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB52651   72 LIEREMTVLTEESQCGIgKWRPKWLQCLGKQLPMIVLLCVYCSIQGLIVNGLVPSAISSIERRFKFSTSHMGRIVQFYDF 151  Caenorhabditis el...
Q92959      1 MGLLPKLGASQGSDTST-SRAGRCARSVFGNIKVFVLCQGLLQLCQLLYSAYFKSSLTTIEKRFGLSSSSSGLISSLNEI 79   human
P46720      1 MEETEKKIATQEG---------RL----FSKMKVFLLSLTCACLTKSLSGVYMNSMLTQIERQFDISTSVAGLINGSFEI 67   Norway rat
AAC32804    1 MGETEKRVATHEV---------RC----FSKIKMFLLALTWAYVSQSLSGIYMNTMLTQIERQFDIPISIVGFINGSFEI 67   Norway rat
BAA11476    1 MGDLEKGAATHGA---------GC----FAKIKVFLMALTCAYVSKSLSGTFMSSMLTQIERQFGIPTAIVGFINGSFEI 67   Norway rat
P46721      1 MGETEKRIETHRI---------RC----LSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEI 67   human
AAB52636   18 LASSTTMGEADETPFGFsWFRPKGLQWLSNFIPFMSILSANAMLQGAIVNGLVSVSISSIEKRFKLTSTQSGIFAATYDV 97   Caenorhabditis el...
AAA81087   95 FPQGHHDINTTEVSAKL-KPTAGQLASNSTLKQLLSYQLIRDRMPHDTYMSLINLEDDTTPIEEYQPIGRPPKIG-QGQS 172  Caenorhabditis el...
AAB52651  152 GYVLLCIPVSYFGGRHSKPAVLAAGLACMALGSLIFSAPHIMSDSYSAsqSNMSFGTCSIEHLLQNDMTsPEALAQIQCQ 231  Caenorhabditis el...
Q92959     80 SNAILIIFVSYFGSRVHRPRLIGIGGLFLAAGAFILTLPHFLSEPYQY--TLASTGNNSRLQAELCQKH-WQDLPPSKCH 156  human
P46720     68 GNLFFIVFVSYFGTKLHRPVVIGIGCVIMGLGCLLMSLPHFFMGRYEYetTISPTGNLSS-NSFLCMENrTQTLKPTQDP 146  Norway rat
AAC32804   68 GNFLLIIFVSYFGTKLHRPIMIGVGCVIMGLGCFLMSLPHFLMGRYEYetTISPTSNLSS-NSFLCMENrSQTLKPTQDP 146  Norway rat
BAA11476   68 GNLLLIIFVSYFGMKLHRPIVIGVGCAVMGLGCFIISLPHFLMGRYEYetTILPTSNLSS-NSFLCMENqTQTLNPAQDP 146  Norway rat
P46721     68 GNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYesTVSVSGNLSS-NSFLCMENgTQILRPTQDP 146  human
AAB52636   98 FVTVMLIPLALYATKVNKVKCIGLGMMIVGIGSILVIIPEYTAGPYSVg-EVKKDVCVTGGPDKVCSEG----------S 166  Caenorhabditis el...
AAA81087  173 GNSTYTIDGWLFNEALVAAENLIAN--NTSQNTLRSSLSLFIHRRTNTstKDIQKIRISAAAPFTFCGKlTNSLRAVIKD 250  Caenorhabditis el...
AAB52651  232 SENQDQHSssNLYFYLFCFAHFLHGIGATPLFTIGVSYIDENVGTAKSSLFVGIFYSFAVFGPAIGFLGASVSLQYHTDF 311  Caenorhabditis el...
Q92959    157 STTQNPQKetSSMWGLMVVAQLLAGIGTVPIQPFGISYVDDFSEPSNSPLYISILFAISVFGPAFGYLLGSVMLQIFVDY 236  human
P46720    147 AECVKEMK--SLMWICVMVGNIIRGIGETPIVPLGISYIEDFAKSENSPLYIGILEMGKVAGPIFGLLLGSYCAQIYVDI 224  Norway rat
AAC32804  147 AECIKEMK--SLMWIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGILETGKVFGPIVGLLLGSFCASIYVDT 224  Norway rat
BAA11476  147 AECVKEVK--SLMWIYVLVGNIIRGIGETPIMPLGVSYIENFAKSENSPLYIGILETGKMIGPIFGLLLGSFCASIYVDT 224  Norway rat
P46721    147 SECTKEVK--SLMWVYVLVGNIVRGMGETPILPLGISYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDT 224  human
AAB52636  167 SDTFSAHR----ELLLLLLSQAFVGIGASPLFTYGITCLDEFDSHKRTGRNLALYMIASTVGPALAFVGCGFMLRLWGDW 242  Caenorhabditis el...
AAA81087  251 SKCKEQTSn-SYPFLVFFFSLLLLGIGRTVPWSLGVPLLDDNIKKKSLPAYFGAISSIRVLGPICGYMIGSFCNKFYYTL 329  Caenorhabditis el...
AAB52651  312 WHLPPEqilKVSSGETDPTWVGAWWLSFIAASFVGFVAVLPLASLPKVLPASLKWHRSRLHDAAVANrrrtpeccgmpgs 391  Caenorhabditis el...
Q92959    237 GRVNTA---AVNLVPGDPRWIGAWWLGLLISSALLVLTSFPFFFFPRAMPIGAKRAPATADEARKLE------------- 300  human
P46720    225 GSVNTD---DLTITPSDTRWVGAWWIGFLVCAGVNILTSIPFFFLPKALPKKGQQENVAVTKDGKVEk------------ 289  Norway rat
AAC32804  225 GSVNTD---DLTITPTDTRWVGAWWIGFLICAGVNILSSIPFFFFPKTLPKEGLQDDVDGTNNDKEEk------------ 289  Norway rat
BAA11476  225 GSVNTD---DLTITPTDIRWVGAWWIGFLVCAGVNILISIPFFFFPKTLPKEGLQENVDGTENAKEEs------------ 289  Norway rat
P46721    225 GFVNTD---DLIITPTDTRWVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDk------------ 289  human
AAB52636  243 RTSPAE---MGIDNSADPRFIGMWWIGFVVCGFVALFTAFPLIMFPKRLKDTTVRKANDVHRTDASLd------------ 307  Caenorhabditis el...
AAA81087  330 NPPN-------GLTPADPTWIGAWWMGFLFIGSIALFPSTMLFFFPQGKEGDGSAVQLRDVHKEKLKk------------ 390  Caenorhabditis el...
AAB52651  392 nktaalnsdapmadnfgsnkaikkfdyttfkmlnkifeiteqasllyssipargRGPLWYKIWLDVRHIPIAIYRILTNW 471  Caenorhabditis el...
Q92959    301 ------------------------------------------------------EAKSRGSLVDFIKRFPCIFLRLLMNS 326  human
P46720    290 -----------------------------------------------------yGGQAREENLGITKDFLTFMKRLFCNP 316  Norway rat
AAC32804  290 -----------------------------------------------------hREKAKEENRGITKDFLPFMKSLSCNP 316  Norway rat
BAA11476  290 -----------------------------------------------------tEKRPRKKNRGITKDFFPFLKSPVLQP 316  Norway rat
P46721    290 -----------------------------------------------------qKEEVKKEKYGITKDFLPFMKSLSCNP 316  human
AAB52636  308 -----------------------------------------------------------KDFSDHKYEFFKIIFMLFKNK 328  Caenorhabditis el...
AAA81087  391 -----------------------------------------------------sVDEDRTIT-MKLKDFAKSCKKVLSTK 416  Caenorhabditis el...
AAB52651  472 LFMIITSAMAIDSLVVTGASSFMSKYLERQFSVRPSKANLLIGCVMVPMAGMGCMVTGGIVNHFRLNSSKMLKFAIGLIF 551  Caenorhabditis el...
Q92959    327 LFVLVVLAQCTFSSVIAGLSTFLNKFLEKQYGTSAAYANFLIGAVNLPAAALGMLFGGILMKRFVFSLQAIPRIATTIIT 406  human
P46720    317 IYMLFILTSVLQVNGFINKFTFLPKYLEQQYGKSTAEAIFLIGVYSLPPICLGYLIGGFIMKKFKITVKKAAYLAFCLSV 396  Norway rat
AAC32804  317 IYMLLILTSVLQINAFINMFTFLPKYLEQQYGKSTAEVVLLIGVYNLPPICIGYLLIGFIMKKFKITVKKAAYMAFCLSL 396  Norway rat
BAA11476  317 DLHAVHPYKVLQVNAFNIYFSFLPKYLENQYGKSTAEVIFLMGVYNLPAICIGYLIAGFMMKKFKITVKTAAFLRFCLSL 396  Norway rat
P46721    317 IYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGIYNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSL 396  human
AAB52636  329 TCMCVILMQTIEAMLMNGYITFIPKLLETLLGFSSGNASLITGGVVVPVGIVASYIGGRISKLFENRFKPSMYFVIVFGI 408  Caenorhabditis el...
AAA81087  417 IYMGSVLGRVCDVLAFKGYIVFLPKYLENHFGIPQYLVHRYMAMFGVFGFGLGVATGGYVTKKLKLNGRRAAMFVMLMST 496  Caenorhabditis el...
AAB52651  552 LS-LLFSPMYLIYCPHAPLVGVDSayPEFDGSIPDYNAtyskdpelmnSCNKQCTCDPSEYRPVCAELDdgrqFTYYSPC 630  Caenorhabditis el...
Q92959    407 ISmILCVPLFFMGCSTPTVAEVYP--PSTSSSIHPQSP----------ACRRDCSCPDSIFHPVCGDNG----IEYLSPC 470  human
P46720    397 FEyLLFLCHFMLTCDNAAVAGLTTsyKGVQHQLHVESKvl-------aDCNTRCSCSTNTWDPVCGDNG----VAYMSAC 465  Norway rat
AAC32804  397 FEyLLYFLHFMITCDNFPVAGLTAlyEGVHHPLYVENKvl-------aDCNRGCSCSTNSWDPVCGDNG----LAYMSAC 465  Norway rat
BAA11476  397 SEySFGFCNFLITCDNVPVAGLTNsyERDQKPLYLENNvl-------aDCNTRCSCLTKTWDPVCGDNG----LAYMSAC 465  Norway rat
P46721    397 LEyLLYFLSFLMTCENSSVVGINTsyEGIPQDLYVENDif-------aDCNVDCNCPSKIWDPVCGNNG----LSYLSAC 465  human
AAB52636  409 MA-AGCSSCLLIRCESLNVYGVNV--PSSDLPRYGALEt----------CSENCHCDS-FFNPVCSEDSk---LTFLSPC 471  Caenorhabditis el...
AAA81087  497 LNvCLYSGKIFIGCESIVNSIGSN----NRQTNYNFTR----------ECNSQCSCENARLYPVCDQTG----FAYFSPC 558  Caenorhabditis el...
AAB52651  631 YAGC----SETYSASLKEYTECSCVpTNTKNRPRIVKKGvcEPQCTELLWFLLLFAPLSFCTFAIAVPIISVILRTVDYN 706  Caenorhabditis el...
Q92959    471 HAGCsninMSSATSKQLIYLNCSCV-TGGSASAKTGSCP--VPCAHFLLPAIFLISFVSLIACISHNPLYMMVLRVVNQE 547  human
P46720    466 LAGCk---KFVGTGTNMVFQDCSCIqSLGNSSAVLGLCKkgPECANRLQYFLILTIIISFIYSLTAIPGYMVFLRCVKSE 542  Norway rat
AAC32804  466 LAGCk---KSVGTGTNMVFQNCSCIrSSGNSSAVLGLCKkgPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLRCIKPE 542  Norway rat
BAA11476  466 LAGCe---KSVGTGTNMVFHNCSCIqSPGNSSAVLGLCNkgPECTNKLQYLLILSGFLSILYSFAAIPGYMVFLRCIKSE 542  Norway rat
P46721    466 LAGCe---TSIGTGINMVFQNCSCIqTSGNSSAVLGLCDkgPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSE 542  human
AAB52636  472 HAGCa--dMPGIKFGASNWTNCGCS---KNTIVKKGYCD--ASCQKQIYQFIIMFIALSFCIFITAPVLQSSSLRVVNHK 544  Caenorhabditis el...
AAA81087  559 HAGCr---EAMQYGSDPVLDFTSCQcAPGGVVSKKFCEN---TCKTSSVIFFLTVLPGSFVAGLGVVPAMLILLRSVPPE 632  Caenorhabditis el...
AAB52651  707 ERSFALGIQWIMIRVIGTIPAPVLFGWMFDVSCIKYQsDSCGSSSGGCLMYSNQYLANLFLTFTISGQIITLAILIVVLM 786  Caenorhabditis el...
Q92959    548 EKSFAIGVQFLLMRLLAWLPSPALYGLTIDHSCIRWN-SLCLGRRGACAYYDNDALRDRYLGLQMGYKALGMLLLCFISW 626  human
P46720    543 EKSLGVGLHTFCIRVFAGIPAPVYFGALIDRTCLHWG-TLKCGQRGACRMYDINSFRHIYLGLPIALRGSSYLPAFFILI 621  Norway rat
AAC32804  543 KKSLGIGLHAFCTRVFAGIPAPIYFGALIDRTCLHWG-TLKCGEPGACRMYNINNFRRIYLVLPAALRGSSYLPALFILI 621  Norway rat
BAA11476  543 EKSLGIGIHAFCIRVFAGIPAPIYFGALIDRTCLHWG-TQKCGAPGR-RMYDINSFRRIYLGMSAALRGSSYLPAFVIVI 620  Norway rat
P46721    543 EKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWG-TLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILI 621  human
AAB52636  545 HRDHFTCFGWLWMRILGSIPGAIVFGYIIDVNCMYWQ---KDCVSQKCQFYNASNLGWAFFYFTIAVKFTGGILLFLAAY 621  Caenorhabditis el...
AAA81087  633 TRSLSLGLQGMAVSLFGTLPSPILWGLVIDAACLVWD-KACNGARGSCSIYHPDRLRVWMHLLYVVIRTVALITDVYVWK 711  Caenorhabditis el...
AAB52651  787 IFGA 790  Caenorhabditis elegans
Q92959    627 RVKK 630  human
P46720    622 LMRK 625  Norway rat
AAC32804  622 LMRK 625  Norway rat
BAA11476  621 LTRK 624  Norway rat
P46721    622 LLRK 625  human
AAB52636  622 CYQE 625  Caenorhabditis elegans
AAA81087  712 HAKN 715  Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap