Conserved Protein Domain Family
2A060602

?
TIGR00918: 2A060602 
The Eukaryotic (Putative) Sterol Transporter (EST) Family
Statistics
?
PSSM-Id: 273338
View PSSM: TIGR00918
Aligned: 4 rows
Threshold Bit Score: 1894.99
Threshold Setting Gi: 552099
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q90693     42 RAAAPdreylqrpsycdaafaleQIAKGratGRRAPLWLRAKFQRLLFNLGCYIQKNCGKFLVVG-LLYSAFAVGLRAAN 120  chicken
AAD25953   19 RTAAP------------------QILAG---SLKAPLWLRAYFQGLLFSLGCGIQRHCGKVLFLGlLAFGALALGLRMAI 77   human
AAA28696   17 VDEKLfsdlyirtswvdaqvaldQIDKGkarGSRTAIYLRSVFQSHLETLGSSVQKHAGKVLFVAiLVLSTFCVGLKSAQ 96   fruit fly
CAB39726   30 RTAAAdleylqrpsycdaafaleQISEGnatGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGlLIFGAFAVGLRAAN 109  zebrafish
Q90693    121 LETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPQEDGTNVLTTEALRQHLDSALQASRVHVYMYNRQWKLE 200  chicken
AAD25953   78 IETNLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTALQEGENILTPEALGLHLQAALTASKVQVSLYGKSWDLN 157  human
AAA28696   97 IHSKVHQLWIQEGGRLEAELAYTQKTIGEDESATHQLLIQTTHDPNASVLHPQALLAHLEVLVKATAVKVHLYDTEWGLR 176  fruit fly
CAB39726  110 LETDVEKLWVEVGGRVNQELKYTRQKIGEEAMFSPQLMIQTPRQEGANILTVEALKQHLDSAIKASRVHVYMYNRQWTLE 189  zebrafish
Q90693    201 HLCYKSGELITEAG-YMDQIIEYLYPCLIITPLDCFWEGAKLQS--GTAYLLGK-PPLQWINFDPLEFLEELKKINYq-- 274  chicken
AAD25953  158 KICYKSGVPLIENG-MIERMIEKLFPCVILTPLDCFWEGAKLQG--GSAYLPGR-PDIQWTNLDPEQLLEELGPFAS--- 230  human
AAA28696  177 DMCNMPSTPSFEGIyYIEQILRHLIPCSIITPLDCFWEGSQLLGpeSAVVIPGLnQRLLWTTLNPASVMQYMKQKMSeek 256  fruit fly
CAB39726  190 HLCYKSGELVTETN-VVDQILEKLHPCLVITPLDCFWEGAKLHS--GTFYLPGK-PPLQWTNFDPMGFIAELKMLKYq-- 263  zebrafish
Q90693    275 ----VESWEEMLNKAEVGHGYMDRPCLNPADPDCPITAPNKNSTKPLDVALVLSGGCYGLSRKYMHWQEELIIGGTVKNS 350  chicken
AAD25953  231 ----LEGFRELLDKAQVGQAYVGRPCLHPDDLHCPPSAPNHHSRQAPNVAHELSGGCHGFSHKFMHWQEELLLGGMARDP 306  human
AAA28696  257 isfdFETVEQYMKRAAIGSGYMEKPCLNPLNPNCPDTAPNKNSTQPPDVGAILSGGCYGYAAKHMHWPEELIVGGRKRNR 336  fruit fly
CAB39726  264 ----VDSWEEMLVKADVGQGYMNRPCLNPADPDCPLSAPNKNTTGPFDVAPVLTGGCYGLSKKYMHWQEELIVGGTKKND 339  zebrafish
Q90693    351 SGKLVSAQALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRMYVEVVHQSVAQNS----TQKVLSFTTTT 426  chicken
AAD25953  307 QGELLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASTVLQAWQRRFVQLAQEALPENA----SQQIHAFSSTT 382  human
AAA28696  337 SGHLRKAQALQSVVQLMTEKEMYDQWQDNYKVHHLGWTQEKAAEVLNAWQRNFSREVEQLLRKQSriatNYDIYVFSSAA 416  fruit fly
CAB39726  340 SGKLLSAQAFQTMFQLMTPKQMYEHLKGYDEVSHINWNEDKAAAILEAWQRKYSEAVQQSVPVNS----SQKVLTFTTTT 415  zebrafish
Q90693    427 LDDILKSFSDVSVIRVASGYLLMLAYACLTMLRW-DCAKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPF 505  chicken
AAD25953  383 LDDILHAFSEVSAARVVGGYLLMLAYACVTMLRW-DCAQSQGSVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPF 461  human
AAA28696  417 LDDILAKFSHPSALSIVIGVAVTVLYAFCTLLRWrDPVRGQSSVGVAGVLLMCFSTAAGLGLSALLGIVFNAASTQVVPF 496  fruit fly
CAB39726  416 LEDILKPFSDVSVIRIASGYLLMLAYACLTMLRW-DCAKSQGAVGLAGVLLVTLSVAAGLGLCSLLGISFNAATtQVLPF 494  zebrafish
Q90693    506 LALGVGVDDVFLLAHAFSETGQNkrIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNF 585  chicken
AAD25953  462 LALGIGVDDVFLLAHAFTEALPG--TPLQERMGECLQRTGTSVVLTSINNMAAFLMAALVPIPALRAFSLQAAIVVGCTF 539  human
AAA28696  497 LALGLGVDHIFMLTAAYAESNRR------EQTKLILKKVGPSILFSACSTAGSFFAAAFIPVPALKVFCLQAAIVMCSNL 570  fruit fly
CAB39726  495 LALGVGVDDVFLLAHAFSETGQNkrIPFEDRTGECLKRTGASVVLTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNF 574  zebrafish
Q90693    586 AMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVTRVIQIEPQ-AYAENdni--cysSPPPYSSHsfahetqitMQSTVQ 662  chicken
AAD25953  540 VAVMLVFPAILSLDLRRRHCQRLDVLCCFSSPCSAQVIQILPQ-ELGDG--------TVPVGIAH---------LTATVQ 601  human
AAA28696  571 AAALLVFPAMISLDLRRRTAGRADIFCCCFP-----VWKEQPKv-------------APP-----------------VLP 615  fruit fly
CAB39726  575 AMVLLIFPAILSMDLYRREDRRFDIFCCFVSPCANRVIQLEPQaAYADSsadssrysPPPSYSSHsfaqhtqitMQSTVQ 654  zebrafish
Q90693    663 LRTEYDPHTQAYYTTAEPRSEISVQPvt----------------------------vtQDSLSCQSPESASSTRDLLSQF 714  chicken
AAD25953  602 AFTHCEASSQHVVTILPPQAHLVPPP--------------------------------SDPLGSELFSPGGSTRDLLGQE 649  human
AAA28696  616 LNNNNGRGARHPKSCNNNRVPLPAQN----------------------------------PLLEQRADIPGSSHSLAS-- 659  fruit fly
CAB39726  655 LRTEYDPRTQAYYTTGEPHSHISVQPyapntnpnpnpnrnnndnnctnssssavpgvaTDTASCQSPDGASSTRDLLSQF 734  zebrafish
Q90693    715 SDS--SVHCLEPPCTKWTLSTFAEKHYAPFLLKPKAKVVVIFLFLGLLGLSLYGTTRVRDGLDLTDIVPRDTREYDFIAA 792  chicken
AAD25953  650 EETrqKAACKSLPCARWNLAHFARYQFAPLLLQSHAKAIVLVLFGALLGLSLYGATLVQDGLALTDVVPRGTKEHAFLSA 729  human
AAA28696  660 ----------------FSLATFAFQHYTPFLMRSWVKFLTVMGFLAALISSLYASTRLQDGLDIIDLVPKDSNEHKFLDA 723  fruit fly
CAB39726  735 GDS--GIRCLDSPYSRWTFASFAEKHYAPFLLQSTTKVVVIFLFLALLGVSLYGTTRVRDGLELTDIVPRETGEYDFIRA 812  zebrafish
Q90693    793 QFKYFSFYNMYIVTQK-ADYPNVQHLLYELHRSFSNVTYVLLEGDRQLPKMWLHYFRDWLQGLQDAFDSDWETGKITYSN 871  chicken
AAD25953  730 QLRYFSLYEVALVTQGgFDYAHSRRALFDLHQRFSSLKAVLPPPATQAPRTWLHYYRSWLQGIQAAFDQDWASGRITRHS 809  human
AAA28696  724 QTRLFGFYSMYAVTQGnFEYPTQQQLLRDYHDSFVRVPHVIKNDNGGLPDFWLLLFSEWLGNLQKIFDEEYRDGRLTKEC 803  fruit fly
CAB39726  813 QFRYSSFYNMYVVTQR-VDYAQIQPQLYELHQRFGSVKYILREENGQLPRMWPHYFRDWLLGLQEAFDKDWQAGRITQGN 891  zebrafish
Q90693    872 YK-NGSDDAVLAYKLLVQTGNRAKPIDISQLTKQRLVDADGIINPNAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHD 950  chicken
AAD25953  810 YR-NGSEDGALAYKLLIQTGDAQEPLDFGQLTTRKLVEREGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHD 888  human
AAA28696  804 WFpNASSDAILAYKLIVQTGHVDNPVDKELVLTNRLVNSDGIINQRAFYNYLSAWATNDVFAYGASQGKLYPEPRQYFHQ 883  fruit fly
CAB39726  892 YR-NGTDDGVLAYKLLVQTGRREK-----TITRQRLVSADGIINPNAFYIYLSAWVSNDPVAYAASQANIRPHPPEWLHD 965  zebrafish
Q90693    951 KADYMPETrLRIPAAEPIEYAQFPFYLNGLRETSDFVEAIEKVRAICNNYTSLGIASYPNGYPFLFWEQYIGLRHWLLLS 1030 chicken
AAD25953  889 KYDTTGEN-LRIPPAQPLEFAQFPFLLRGLQKTADFVEAIEGARAACAEAGQAGVHAYPSGSPFLFWEQYLGLRRCFLLA 967  human
AAA28696  884 PNEYD----LKIPKSLPLVYAQMPFYLHGLTDTSQIKTLIGHIRDLSVKYEGFGLPNYPSGIPFIFWEQYMTLRSSLAMI 959  fruit fly
CAB39726  966 RTDSIPASrLNIPAAEPIEYAQFPFYLNGLRETPQFVEAIESVRAICNNYSRQGLPSYPNGYPFLFWEQYVGLRHWLLLS 1045 zebrafish
Q90693   1031 ISVVLACTFLVCALFLLNPWTAGIIVVVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHIALAFLTAIGDK 1110 chicken
AAD25953  968 VCILLVCTFLVCALLLLNPWTAGLIVLVLAMMTVELFGIMGFLGIKLSAIPVVILVASVGIGVEFTVHVALGFLTTQGSR 1047 human
AAA28696  960 LACVLLAALVLVSLLLLSVWAAVLVILSVLASLAQIFGAMTLLGIKLSAIPAVILILSVGMMLCFNVLISLGFMTSVGNR 1039 fruit fly
CAB39726 1046 ISVVLACTFLVCAVFLLNPWTAGIIVLVLSLMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDR 1125 zebrafish
Q90693   1111 NRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPACGRN 1190 chicken
AAD25953 1048 NLRAAHALEHTFAPVTDGAISTLLGLLMLAGSHFDFIVRYFFAALTVLTLLGLLHGLVLLPVLLSILGPPPEVIQMYKES 1127 human
AAA28696 1040 QRRVQLSMQMSLGPLVHGMLTSGVAVFMLSTSPFEFVIRHFCWLLLVVLCVGACNSLLVFPILLSMVGPEAELVPLEHPD 1119 fruit fly
CAB39726 1126 NKRAVLALEHMFAPVLDGAFSTLLGVLMLAGSEFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSYFGPCPEVSPADGRS 1205 zebrafish
Q90693   1191 RLPTPSPEPPPSIVR 1205 chicken
AAD25953 1128 PEILSPPAPQGGGLR 1142 human
AAA28696 1120 RISTPSPLP----VR 1130 fruit fly
CAB39726 1206 RLPTPSPEPPPQVVR 1220 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap