Conserved Protein Domain Family
3a01208

?
TIGR00958: 3a01208 
Conjugate Transporter-2 (CT2) Family protein
[Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 273363
View PSSM: TIGR00958
Aligned: 11 rows
Threshold Bit Score: 871.737
Threshold Setting Gi: 3790658
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC71121   3 IDAAITNVSFGYFAPGWKFNYdSFLGIITFslPYHftTTPYEFQIFSFIRQSFCAIavlliiLNKRE----------KVK 72  Caenorhabditis elegans
P36371     1 MALSYLRPWVSLLLADMALLG-LLQGSLGN--LLP--QGLPGLWIEGTLRLGVLWG------LLKVGe---------LLG 60  house mouse
P36372     1 MALSHPRPWASLLLVDLALLG-LLQSSLGT--LLP--PGLPGLWLEGTLRLGVLWG------LLKVGg---------LLR 60  Norway rat
AAA96713   1 MALSYLRPWASLLLVDMALLA-LLQGSPGN--LLP--LGLPGLWLEGTLRLGGLWG------LLAVGg---------LLG 60  golden hamster
Q03519     1 MRLPDLRPWTSLLLVDAALLW-LLQGPLGT--LLP--QGLPGLWLEGTLRLGGLWG------LLKLRg---------LLG 60  human
AAB41964   2 AAHVW-LAAALLLLVDWLLLRpMLPGIFSL--LVPe-VPLLRVWVVGLSRWAILGLgvrgvlGVTAGah-------gWLA 70  house mouse
CAA40742  17 AAHAWPTAALLLLLVDWLLLRpVLPGIFSL--LVPe-VPLLRVWAVGLSRWAILGLgvrgvlGVTAGar-------gWLA 86  Norway rat
CAA40741  78 ASLAW-LGTVLLLLADWVLLRtALPRIFSL--LVPtaLPLLRVWAVGLSRWAVLWLgacgvlRATVGsksenagaqgWLA 154 human
AAB95060  19 IGLDLLVNVFGLAWNGKYFTFdNIAHWFDLa-NYSflKNPAVALIRDSILLG-GAVsawaspSGFSQ----------VAE 86  Caenorhabditis elegans
AAC68724  16 ASIDFLACLLFACLHDGTFKFaNFTSQFG---DFSffTSTIDLFLLQFFRFALWMVpaaihvANKAD----------TLT 82  Caenorhabditis elegans
CAA98006   1 -MKTYVLLYGKLIMTTMILNTgRFEEWYKVciIALkeKEIYVPSSPIAMLNGRLPLlrlgicRNMLSr---------PRL 70  baker's yeast
AAC71121  73 VLFPVVICNAVVVYSLSLIKFLAFSE--DSNQLYFPGLWF----SVIWSILSGFIQVLVWYFVFTsnpfdyhrllnttae 146 Caenorhabditis elegans
P36371    61 LVGTLLPLLCLATPLFFSLRALVGGTasTSVVRVASASWG----WLLAGYGAVALSWAVWAVLSP--------------- 121 house mouse
P36372    61 LVGTFLPLLCLTNPLFFSLRALVGSTmsTSVVRVASASWG----WLLADYGAVALSLAVWAVLSP--------------- 121 Norway rat
AAA96713  61 RVGTFPPLLCLATPLFFSLRALVGGTmsSPAVRVASASWV----WLLADYKAAALGWAVWAVLSP--------------- 121 golden hamster
Q03519    61 FVGTLLLPLCLATPLTVSLRALVAGAsrAPPARVASAPWS----WLLVGYGAAGLSWSLWAVLSP--------------- 121 human
AAB41964  71 ALQPLVAALSLALPGLALFRELAAWGtlREGDSAGLLYWNsrpdAFAISYVAALPAAALWHKLGS--------------- 135 house mouse
CAA40742  87 ALQPLVAALGLALPGLASFRKLSAWGalREGDNAGLLHWNsrldAFVLSYVAALPAAALWHKLGG--------------- 151 Norway rat
CAA40741 155 ALKPLAAALGLALPGLALFRELISWGapGSADSTRLLHWGshptAFVVSYAAALPAAALWHKLGS--------------- 219 human
AAB95060  87 NVKNVVFAMMLLIVAFAPSKLLAFYE--DDNIRLAVGDWI----LMIWCIFASLLLQGIWTSVLAhvte--------vaa 152 Caenorhabditis elegans
AAC68724  83 MWKEPIFCSALLICAASPTKLLLLTEklKPDEFLTFGDTA----FLVWNFISAIILNSSWTRYFSr-------------- 144 Caenorhabditis elegans
CAA98006  71 AKLPSIRFRSLVTPSSSQLIPLSRLClrSPAVGKSLILQS-----FRCNSSKTVPETSLPSASPIs-------------- 131 baker's yeast
AAC71121 147 nAGTSVTEtaaetvrdtetasnvESGSSTAprap-lhkVLLRLLSYCGHQWPWFASGFVFLTVYALARVFIPNYTAQVIS 225 Caenorhabditis elegans
P36371   122 -AGVQEKE---------------PGQENRT--------LMKRLLKLSRPDLPFLIAAFFFLVVAVWGETLIPRYSGRVID 177 house mouse
P36372   122 -AGAQEKE---------------PGQENNRa-------LMIRLLRLSKPDLPFLIVAFIFLAMAVWWEMFIPHYSGRVID 178 Norway rat
AAA96713 122 -PGAREKE---------------AGQEKNKs-------LMWQLLRLSRPDLPFLMVAFFFLAWAVLGETLIPHYSGRVID 178 golden hamster
Q03519   122 -PGAQEKE---------------QDQVNNKv-------LMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVID 178 human
AAB41964 136 -LWAP------------------SGNRDAGd-------MLCRMLGFLGPKKRRLYLVLVLLILSWLGEMAIPFFTGRITD 189 house mouse
CAA40742 152 -FWAP------------------SGHKGAGd-------MLCRMLGFLDSKKGRLHLVLVLLILSCLGEMAIPFFTGRITD 205 Norway rat
CAA40741 220 -LWVP------------------GGQGGSGn-------PVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTD 273 human
AAB95060 153 gTGDSLLFgdaeh-----eerlrQEEAEKAaeqretfqLLFRLLGYMGRQWKYYGMAFFFLFCYSLSRVFIPYYTGEVVT 227 Caenorhabditis elegans
AAC68724 145 -TPSSYIIl-------------eDEDLEVApkq--tfeLIFRLLQYCKREWLWHISGFSWLFIYSITRIFVPYYTGQVIA 208 Caenorhabditis elegans
CAA98006 132 -KGSAR-Sah------------aKEQSKTDdy-----kDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLD 192 baker's yeast
AAC71121 226 DIVNKRG--IQALIHSIIVLTCLTATSSLFGGLRGGC---------FDYATALVTLRIRLDLFTSLIRQDIAFYDTAKTG 294 Caenorhabditis elegans
P36371   178 ILGGDFD--PDAFASAIFFMCLFSVGSSFSAGCRGGS---------FLFTMSRINLRIREQLFSSLLRQDLGFFQETKTG 246 house mouse
P36372   179 ILGGDFD--PDAFASAIFFMCLFSVGSSLSAGCRGGS---------FLFAESRINLRIREQLFSSLLRQDLAFFQETKTG 247 Norway rat
AAA96713 179 ILGSDFD--PXSFASAIFFMCLFSVGSSLSAGCRGGS---------FLFTMSRINLRIRERLFSSLLRQDLGFFQENKTG 247 golden hamster
Q03519   179 ILGGDFD--PHAFASAIFFMCLFSFGSSLSAGCRGGC---------FTYTMSRINLRIREQLFSSLLRQDLGFFQETKTG 247 human
AAB41964 190 WILQDKT--VPSFTRNIWLMSILTIASTALEFASDGI---------YNITMGHMHGRVHREVFRAVLRQETGFFLKNPAG 258 house mouse
CAA40742 206 WILQDKT--APSFARNMWLMCILTIASTVLEFAGDGI---------YNITMGHMHSRVHGEVFRAVLHQETGFFLKNPTG 274 Norway rat
CAA40741 274 WILQDGS--ADTFTRNLTLMSILTIASAVLEFVGDGI---------YNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTG 342 human
AAB95060 228 AVFGDKAs-YEKLHKTVFIMGMLSLASTVFGGLRGGS---------FTYAHATIDRQIRNDLFRSVVKQEIGFFDMNKTG 297 Caenorhabditis elegans
AAC68724 209 TVVATKS--YPALSNAVYIMTIISLVSAVAAGFRGGS---------FEYAYARIQRAIRYDLFHGLVKQDVAFYDAHKTG 277 Caenorhabditis elegans
CAA98006 193 TLKTSSGsdFFDLKIPIFSLPLYEFLSFFTVALLIGCaanfgrfilLRILSERVVARLRANVIKKTLHQDAEFFDNHKVG 272 baker's yeast
AAC71121 295 DTMSRLTSDCQTISSTVSTNVNVFMRNGVMLIGALAFMILMSWRLAMVTFIAVPLVGFITKAYSSFYDKISEKLQQTIAE 374 Caenorhabditis elegans
P36371   247 ELNSRLSSDTSLMSRWLPFNANILLRSLVKVVGLYFFMLQVSPRLTFLSLLDLPLTIAAEKVYNPRHQAVLKEIQDAVAK 326 house mouse
P36372   248 ELNSRLSSDTSLMSQWLSLNANILLRSLVKVVGLYYFMLQVSPRLTFLSLLDLPLTIAAEKVYNPRHQAVLKEIQDAVAK 327 Norway rat
AAA96713 248 ELNSRLSSDTSKMSRWLPYNANILLRSLVKVIGLYCFMLQVSPRLTFLSLLDLPLTIAAEKVYNPRHQAVLTEIQDATAK 327 golden hamster
Q03519   248 ELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVAR 327 human
AAB41964 259 SITSRVTEDTANVCESISDTLSLLLWYLGRALCLLVFMFWGSPYLTLVTLINLPLLFLLPKKLGKVHQSLAVKVQESLAK 338 house mouse
CAA40742 275 SITSRVTEDTSNVCESISDKLNLFLWYLGRGLCLLAFMIWGSFYLTVVTLLSLPLLFLLPRRLGKVYQSLAVKVQESLAK 354 Norway rat
CAA40741 343 NIMSRVTEDTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESLAK 422 human
AAB95060 298 EICSRLSADCQTMSNTLSLYMNVLTRNLTMLFGSLIFMFTLSWKLSMITLINIPIIFLVNKIFGVWYDMLSEETQNSVAK 377 Caenorhabditis elegans
AAC68724 278 EVTSRLAADCQTMSDTVALNVNVFLRNCVMLLGSMIFMMKLSWRLSLVTFILVPIIFVASKIFGTYYDLLSERTQDTIAE 357 Caenorhabditis elegans
CAA98006 273 DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQ 352 baker's yeast
AAC71121 375 TNQMAEEVVSTMRTVRSFACEKKELKRFEDRLSSTLSVNRKKSIAYLFYTWNNEFCDNAILVAVLFYGGHLVMTGKMEKE 454 Caenorhabditis elegans
P36371   327 AGQVVREAVGGLQTVRSFGAEEQEVSHYKEALERCRQLWWRRDLEKDVYLVIRRVMALGMQVLILNCGVQQILAGEVTRG 406 house mouse
P36372   328 AGQVVREAVGGLQTVRSFGAEEQEVRRYKEALERCRQLWWRRDLEKSLYLVIQRVMALGMQVLILNVGVQQILAGEVTRG 407 Norway rat
AAA96713 328 AGQVVREAVGGLQTVRSFGAEEQEVSRYKEALERCRQLWWRRDLERALYLAIRRVMALGMQVLILNCGVQQILAGEVTRG 407 golden hamster
Q03519   328 AGQVVREAVGGLQTVRSFGAEEHEVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQG 407 human
AAB41964 339 STQVALEALSAMPTVRSFANEEGEAQKFRQKLEEMKTLNKKEALAYVAEVWTTSVSGMLLKVGILYLGGQLVIRGTVSSG 418 house mouse
CAA40742 355 STQVALEALSAMPTVRSFANEEGEAQKFRQKLEEMKPLNKKEALAYVTEVWTMSVSGMLLKVGILYLGGQLVVRGAVSSG 434 Norway rat
CAA40741 423 SSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTSGAVSSG 502 human
AAB95060 378 ANDVAEEVLSSIRTVKSFACENYESSRFMTFLNVTLKIATRKVFVVIGLIWSNELLQMGILTIVLWYGGHLVIENKVESG 457 Caenorhabditis elegans
AAC68724 358 SNDVAEEVLSTMRTVRSFSCENVEADRFYGKLTHTLDVTRTKAIAYIGFLWVSELFQSFIIVSVLWYGGHLVLTQKMKGD 437 Caenorhabditis elegans
CAA98006 353 LTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIG 432 baker's yeast
AAC71121 455 QLITFLLYQMQLGENLYYLSYVMSGLMEAVGASRKVFDLMNRKPQFELDGMQRP-FVNGNITFSHVGFTYPSRPNNPVLK 533 Caenorhabditis elegans
P36371   407 GLLSFLLYQEEVGQYVRNLVYMYGDMLSNVGAAEKVFSYLDRKPNLPQPGILAPpWLEGRVEFQDVSFSYPRRPEKPVLQ 486 house mouse
P36372   408 GLLSFLLYQEEVGHHVQNLVYMYGDMLSNVGAAEKVFSYLDRRPNLPNPGTLAPpRLEGRVEFQDVSFSYPSRPEKPVLQ 487 Norway rat
AAA96713 408 GLLSFLLYQEEVGDYVRNLVYMYGDMLSNVGAAEKVFCYIDRKPNLPQPGTLAPsRLEGRVEFQDVTFSYPSRPXKPVLK 487 golden hamster
Q03519   408 SLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPtTLQGVVKFQDVSFAYPNRPDRPVLK 487 human
AAB41964 419 NLVSFVLYQLQFTQAVQVLLSLYPSMQKAVGSSEKIFEYLDRTPCSPLSGSLAPsNMKGLVEFQDVSFAYPNQPKVQVLQ 498 house mouse
CAA40742 435 NLVSFVLYQLQFTRAVEVLLSIYPSMQKSVGASEKIFEYLDRTPCSPLSGSLAPlNMKGLVKFQDVSFAYPNHPNVQVLQ 514 Norway rat
CAA40741 503 NLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPlHLEGLVQFQDVSFAYPNRPDVLVLQ 582 human
AAB95060 458 LLVSFLLYQFQLGENLRELGEVWNGLMQAVGASRKVFEFIDRPPRVENTGTYAPdGMTGKIEFRHVAFSYPIRPDLPIME 537 Caenorhabditis elegans
AAC68724 438 LLVSFLLYQMQLGDNLRQMGEVWTGLMQSVGASRKVFEYIDREPQIQHNGEYMPeNVVGKIEFRNVHFSYPTRSDQPILK 517 Caenorhabditis elegans
CAA98006 433 DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYkPDRGVIEFKDVSFSYPTRPSVQIFK 512 baker's yeast
AAC71121 534 DLTLSIKSGETVALVGPSGGGKSSIVSLIEHFYEPDEGSVTLDGVPIKDINHVYYHQKVALVAQEPVLYNGSVRHNILYG 613 Caenorhabditis elegans
P36371   487 GLTFTLHPGTVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGEPLTEYDHHYLHRQVVLVGQEPVLFSGSVKDNIAYG 566 house mouse
P36372   488 GLTFTLHPGKVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGEPLVQYDHHYLHRQVVLVGQEPVLFSGSVKDNIAYG 567 Norway rat
AAA96713 488 GLTFTLHPGKVTALVGPNGSGKSTVAAPLQNLYQPTGGQLLLDGQPLVQYDHHYLHRQVVLVGQEPVLFSGSVKDNIAYG 567 golden hamster
Q03519   488 GLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYG 567 human
AAB41964 499 GLTFTLHPGTVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGQRLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYG 578 house mouse
CAA40742 515 GLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYG 594 Norway rat
CAA40741 583 GLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYG 662 human
AAB95060 538 DLTFTVEPGEVVALVGPSGGGKSSCIAMLEHFYEPTSGEVLIDGVPVREYDHKFLHTKVALVGQEPVLYARSVTENIGYG 617 Caenorhabditis elegans
AAC68724 518 DLSFTVEPGETVALVGPSGSGKSSCISLLENFYVPNAGQVLVDGVPLEEFEHHYIHKKVR--------WR---------- 579 Caenorhabditis elegans
CAA98006 513 NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYG 592 baker's yeast
AAC71121 614 CDFAT-EDDMLNASKMANVHDFVMELEKG-YDTNCGEKGVQMSGGQKQRIAIARALVRNPAVLILDEATSALDT----ES 687 Caenorhabditis elegans
P36371   567 LRDCE-DAQVMAAAQAACADDFIGEMTNG-INTEIGEKGGQLAVGQKQRLAIARALVRNPRVLILDEATSALDA----QC 640 house mouse
P36372   568 LRDCE-DAQVMAAAQAACADDFIGEMTNG-INTEIGEKGSQLAVGQKQRLAIARALVRNPRVLILDEATSALDA----EC 641 Norway rat
AAA96713 568 LKDCE-DAQVMAAVRAACADDFIGEMPDG-IHTEIGEKGSQLAVGQKQRLAIARALVRNPRVLILDEATSALDS----QC 641 golden hamster
Q03519   568 LQSCE-DDKVMAAAQAAHADDFIQEMEHG-IYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDV----QC 641 human
AAB41964 579 LNRTPtMEEITAVAVESGAHDFISGFPQG-YDTEVGETGNQLSGGQRQAVALARALIRKPLLLILDDATSALDAgnqlRV 657 house mouse
CAA40742 595 LTRTPtMEEITAVAMESGAHDFISGFPQG-YDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDDATSALDAgnqlRV 673 Norway rat
CAA40741 663 LTQKPtMEEITAAAVKSGAHSFISGLPQG-YDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDAnsqlQV 741 human
AAB95060 618 LDKYD-DDMVQNSAKLANAHTFIMNDTTDgYNTNVGEKGSQMSGGQKQRIAIARALVRQPVVLLLDEATSALDA----ES 692 Caenorhabditis elegans
AAC68724 580 ---------------------------------------QFRf------------------------------------- 583 Caenorhabditis elegans
CAA98006 593 LTYTPtKEEIRSVAKQCFCHNFITKFPNT-YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVesegAI 671 baker's yeast
AAC71121 688 EALVQQalSRCAQERTVIIVAHRLSTIEKANKIAVIVKG-CLVQmgtHTELMTDTDgMYYSLV 749 Caenorhabditis elegans
P36371   641 EQALQN--WRSQGDRTMLVIAHRLHTVQNADQVLVLKQG-RLVE---HDQLRDGQD-VYAHLV 696 house mouse
P36372   642 EQALQT--WRSQEDRTMLVIAHRLHTVQNADQVLVLKQG-QLVE---HDQLRDEQD-VYAHLV 697 Norway rat
AAA96713 642 EQALQA--WRSKGDRTVLVIAHRLHTVQNVDQVLVLKQG-QLVE---HSQLREDQD-VYAHLV 697 golden hamster
Q03519   642 EQALQD--WNSRGDRTVLVIAHRLQTVQRAHQILVLQEG-KLQK---LAQL------------ 686 human
AAB41964 658 QRLLYE--SPKRASRTVLLITQQLSLAEQAHHILFLREG-SVGEqgtHLQLMKRGG-CYRAMV 716 house mouse
CAA40742 674 QRLLYE--SPEWASRTVLLITQQLSLAERAHHILFLKEG-SVCEqgtHLQLMERGG-CYRSMV 732 Norway rat
CAA40741 742 EQLLYE--SPERYSRSVLLITQHLSLVEQADHILFLEGG-AIREggtHQQLMEKKG-CYWAMV 800 human
AAB95060 693 EHTVQEaiSKNLKGKTVILIAHRLSTVENADKIVVINKG-KVEQlgnHKTLMEQEG-LYKQLV 753 Caenorhabditis elegans
AAC68724 584 --------DKSFAGLPAILIFGKLPICRKCLECFFIRR---------------------KHLK 617 Caenorhabditis elegans
CAA98006 672 NYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDgSVVEmgkFKELYANPTsALSQLL 732 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap