Conserved Protein Domain Family
ELP3

?
TIGR01211: ELP3 
radical SAM enzyme/protein acetyltransferase, ELP3 family
This family includes elongator complex protein 3 (ELP3) from eukaryotes and related proteins from other lineages. ELP3 is a component of the RNA polymerase II holoenzyme. It has an N-terminal radical SAM domain and C-terminal GNAT acetyltransferase domain. Members of this family are found in eukaryotes, archaea, and a few bacteria (e.g. Atopobium sp). The activity discovered first was an acetyltransferase modification at the N-termini of all four core histones, shown in vitro in eukaryotes. More recently, the radical SAM domain was shown to play a role in zygotic paternal genome demethylation. Family TIGR01212, widespread in prokaryotes, lacks the GNAT acetyltransferase domain but shares extensive sequence similarity with this family (TIGR01211). [Transcription, DNA-dependent RNA polymerase]
Statistics
?
PSSM-Id: 273503
View PSSM: TIGR01211
Aligned: 7 rows
Threshold Bit Score: 870.605
Threshold Setting Gi: 499182349
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58536        18 RILDEYNKGKTLdKKRIEQIKAECLRIHRIGIgHPSNSEILQYATEEEKK-ILIPILRKKPVRTISGVAVVAVMTSPEKC 96  Methanocaldococ...
AAB68213      32 ELTDSLTSGTTR-EINLNGLITKYSKKYKLKQ-QPRLTDIINSIPDQYKK-YLLPKLKAKPVRTASGIAVVAVMCKPHRC 108 baker's yeast
WP_010876452  17 LIINGIISGEIRtRKDLERFKHRVCREMGLER-FMSNSEILEHATPEEKK-VIEGLLRKKPTRTISGVAVVAVMCQPREC 94  Methanothermoba...
WP_010885926  38 EIVEALLSGKVKsREELNKLKIEVARKYHLPK-LPKNSDIWKALPKDKRE-KFRDLLKKKPARTISGVAVVAMMTKPFPC 115 Pyrococcus hori...
WP_010903101  16 ELVSRILAGDVG-KDDIEDAKLDVCGEYAASK-VPKHSDLLDVAPDGRRD-ELEDVLQRKPVRTASGVTPVAIMTSPHTC 92  Halobacterium s...
WP_010901717   6 EMRDVLLSGQIKdKEDLEDVKLELSKKYGLDY-VPSDVEILNSFNFSED---VKKILRRKPTRTISGVAVVAAMTSPERC 81  Thermoplasma ac...
WP_010879889   2 FELAKEIAENARsKEEVLRIKRLFARRHGLST-IPSDAEILRAAKGTELYgKLREILRVKPVRTISGVAVVAVMTSPAPC 80  Archaeoglobus f...
Q58536        97 PHGK-----CIFCPGGVGsvfGDVPQSYTGREPATMRGLMFNFDPYLQTKARIEQLEKVGHPTNKIELIIMGGTFPARDI 171 Methanocaldococ...
AAB68213     109 PHIAytgniCVYCPGGPDsdfEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYVLMGGTFMSLPK 188 baker's yeast
WP_010876452  95 PHGR-----CLYCP---Es--EKAPPSYTGEEPAALRARMYDFHPYRQVYNRLEQLHSIGHPVDKVELIVMGGTFPSHSL 164 Methanothermoba...
WP_010885926 116 PHGR-----CIYCPGGPs---VGSPQSYTGKEPSALRASQYGYHPYIIMMARLKQLYDIGHPIDKVEVIIQGGTFPAVDL 187 Pyrococcus hori...
WP_010903101  93 PHGK-----CLYCPGGPAs-eFTSSQSYTGHEPAAARGVQNDYDPYGQVTLRLHQLRQIGHPVDKVELILMGGTMTARSH 166 Halobacterium s...
WP_010901717  82 PHGK-----CIFCPGGVD---NNSPQSYTGYEPAALRGRNNAYDPYMETFNRIKQLETIGHDTSKIDLIIMGGTFTARDP 153 Thermoplasma ac...
WP_010879889  81 PHGK-----CLPCPGGVEk---NTPQSYVGLEPAAMRGRQHGYDAFKQVTARLRELESIGHDVSKVEIIVMGGTFPARDA 152 Archaeoglobus f...
Q58536       172 EYQDWFIKRCLDAMNG------------------VDASS-----------------------LEEAQKINETAEHRCVAL 210 Methanocaldococ...
AAB68213     189 EYREDFIVKLHNALSG------------------FNGND-----------------------IDEAILYSQQSLTKCVGI 227 baker's yeast
WP_010876452 165 CYQEWFISMCLKAMVDfg--------------aeLRGIRvdvpeh------------hgyvkVEDAQRLNESSPVRCVGM 218 Methanothermoba...
WP_010885926 188 DYQEWFVKCAFKAMNDfhyfkdidnleeklvrliLKGDKsvfkedpefkrawerthrkpyyyLEDEQRKNEKAKVRMVGL 267 Pyrococcus hori...
WP_010903101 167 DYQEWFVKRALQALNDfdp------------dqePAPNQtesfaqdp--------aeydfryLEDVIADNEHGALRNIGT 226 Halobacterium s...
WP_010901717 154 AYQRNFVKGCLDAMNG------------------SIGNS-----------------------LEESIRINETSRHRCIGL 192 Thermoplasma ac...
WP_010879889 153 DYKEKFMLGIFNALNSfn--------------snTKPENd----------------------LERAKRKNERAKARCVGI 196 Archaeoglobus f...
Q58536       211 CIETRPDYCGEKEINQMLKLGATRVELGVQTIYNEILEFCKRGHTVEDTIKATQLLKDSGLKVSYHLMPGMPGSDMEMDK 290 Methanocaldococ...
AAB68213     228 TIETRPDYCTQTHLDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVRSVCETFAVSKDAGYKVVSHMMPDLPNVGMERDI 307 baker's yeast
WP_010876452 219 TFETRPDYCREEDVDRMLGLGVTRVELGVQTIYNYIYQRIKRGHSIRDVVESNRILRDSGVKVAMHLMPGLF-SDFERDL 297 Methanothermoba...
WP_010885926 268 TIETRPDWAFERQIDRMLSFGTTRVELGVQTIFNFIHERTKRGHGVEEIIKATQLLKDAGLKVNYHIMPGLPGSNFDRDL 347 Pyrococcus hori...
WP_010903101 227 TFETKPDWCDPEQVDRMLDLGATKVEVGVQTTFERVNREMHRGHGVQASVDANRRLRDAAFKVGFHMMPGQPGMSKEMVL 306 Halobacterium s...
WP_010901717 193 TVETKPDWFFEREIDEALAYGTTKVELGVQNIDDRILAINNRGHTVADIARSTQLARDAGLKIVYHIMPGMYGSSFEKDL 272 Thermoplasma ac...
WP_010879889 197 TFETRPDYAREEHIREMLRFGGTKVELGVQSLYDDVLERIKRGHGVKEVAEATRLLRDSAFKVGYHIMPGLPGSSFERDL 276 Archaeoglobus f...
Q58536       291 KMFKEIFENPDFKPDMVKIYPCLVIEGTELYEMWKRGEYKPYREEEAIEIISYAKSIMPKWVRTSRIQRDIPATVIVDGV 370 Methanocaldococ...
AAB68213     308 EQFKEYFENPDFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYSANALVDLVARILALVPPWTRIYRVQRDIPMPLVTSGV 387 baker's yeast
WP_010876452 298 RIFRRIFRDPSFRPDMIKIYPCLVTRGSELYSLWERGLYKPYSTEEAVELIVEIKKMMPKWVRTMRIQRDIPSRLIVDGV 377 Methanothermoba...
WP_010885926 348 YTFRTIFEDPRFRPDMLKIYPTLVTRDAPLYAWYKAGLYRPYTTEEALELLVEAYKIFPKWVRVMRIQRDIPAHLIVAGV 427 Pyrococcus hori...
WP_010903101 307 EDFRRLFDDERWKPDYLKIYPTLVVRDTITYDMWRNGDFEPLHNEEAADLVAEIKDMIPRYTRLQRVQRDIPADFIDAGV 386 Halobacterium s...
WP_010901717 273 KSFDLMINDERFKPDMLKIYPTLVTQGTGLYNLWKNGKYRPYTTAETVDLIVEFMRRMPDWIRIQRIQRDIPVQFIVAGV 352 Thermoplasma ac...
WP_010879889 277 RMFRELFENDSFKPDYLKIYPTLVVEGTELYEMWKRGEYEPYTTEEVVELIVMAKRRFPEWVRVQRIQRDIPVKAAI-GL 355 Archaeoglobus f...
Q58536       371 KKSNLGELVYKYMEKHGIKCKCIRCREVGHVMYKKgIMPdiEHIKLCREEYEASGGTEIFLSYEDVKNDILIAFLRLREP 450 Methanocaldococ...
AAB68213     388 DNGNLRELALARMKDLGTTCRDVRTREVGIQEVHHkVQP--DQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKA 465 baker's yeast
WP_010876452 378 RKSNLGEMVYRRLEEEGVRCRCIRCREVGHMSRRG-VRVdeDAVTLMVEEYAATGGREFFLSQEDPENDVLVGFLRLRFP 456 Methanothermoba...
WP_010885926 428 KHSNLGQLVFNELVRRGIRPREIRFREVGHQMQKFgKIPevEHIKLLREDYEASEGQEIFLSFEDVKNDILIGFLRLRIP 507 Pyrococcus hori...
WP_010903101 387 WKSNLRQLARQRMAEHGYTCDCIRCREAGMNDDDP------ENVSLDVETYAAGGGTEQFISIEDFQQDLLVGFARLRFP 460 Halobacterium s...
WP_010901717 353 KRSDIRNLVERRMREEGIKTGEIRYREIGHGTVKe------ENVILKVEGYNAGGGKEYFISYVTESN-RIIGFVRLRIP 425 Thermoplasma ac...
WP_010879889 356 DKGNIRQLVHRRLKEMGYSCRCIRCREVGHKGVRP---EeySKAELVVREYVASEGREFFISFEIPEYDALVGFVRLRFP 432 Archaeoglobus f...
Q58536       451 YKP-FRKEIDDN--TMLVRQLHVCGQEKPLT-KdLKEITWQHKGYGRKLLEEAERIAKEEfGKKKILVTSGIGVREYYR- 525 Methanocaldococ...
AAB68213     466 SKKyTYRKEFTSqrTSIVRELHVYGSVVPLH-S-RDPRKFQHQGFGTLLMEEAERIAKEEhGSEKISVISGVGVRNYYG- 542 baker's yeast
WP_010876452 457 SEE-AHRPEVDDk-TALVRELHVYGSMLPIG-E-RGDAVGQHRGYGEELLARAESLAADN-GMEKILVTSGIGAREYYS- 530 Methanothermoba...
WP_010885926 508 SEK-AHRKEINCcpSAIVRELHVYGPLVPIG-E-KPKYEWQHRGYGRELLSEAERIAREEfDAKKILVISGVGVREYYR- 583 Pyrococcus hori...
WP_010903101 461 NEP-AREELTDA---ALLRELHVYGSEVSVGdD-TGDDQHQHQGYGRQLMERAEHLAADS-GFEKLSVISGIGARQYYKq 534 Halobacterium s...
WP_010901717 426 SDR-AHRQEVMN--TAIIRELKVFGQEVPVG-R-HEEDEWQHRGFGNRLVQEAERITLEE-GLHRILVISGIGVREYFR- 498 Thermoplasma ac...
WP_010879889 433 KEP-FIEVLRDA---ALIRELHVYGRAVPIG-Q--SSDAFQHRGFGERLLKEAEE-IAKE-EYDRIAVISGVGVRDYYR- 502 Archaeoglobus f...
Q58536       526 KLGYERVGAYMGKYL 540 Methanocaldococcus jannaschii DSM 2661
AAB68213     543 KLGYELDGPYMSKRI 557 baker's yeast
WP_010876452 531 KFGYLKEGPYMAKKL 545 Methanothermobacter thermautotrophicus
WP_010885926 584 KFGYRKDGPYVSKRL 598 Pyrococcus horikoshii
WP_010903101 535 QLGYHQDGPYVSKRL 549 Halobacterium salinarum
WP_010901717 499 KRGYEDLGPYVAKRL 513 Thermoplasma acidophilum
WP_010879889 503 KLGYRLRQGYMVKKL 517 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap