Conserved Protein Domain Family
CDC48

?
TIGR01243: CDC48 
AAA family ATPase, CDC48 subfamily
This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Statistics
?
PSSM-Id: 273521
View PSSM: TIGR01243
Aligned: 3 rows
Threshold Bit Score: 1206.27
Threshold Setting Gi: 499168053
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58556         2 VKELKVAEAYQGDVGRGIARIDPYTMEELGLKPGDVIEIEGPKGKAYAIVYRGFLEDAGKGIIRIDGYLRQNAGVAIGDR 81  Methanocaldococ...
WP_010866329   5 SVELRVSEAYPRDVGRKIVRIDRQTAARLGVEVGDFVKVSKGDRSVVAVVWPLRPDDEGRGIIRMDGYLRAALGVTVGDT 84  Aeropyrum pernix
WP_010884779  12 EIKLRVAEALKRDVGRGIVRFDRRYQKMIGVEPGDIVEIE-GERVTAAIVANSHPDDKGLDIIRMDGYIRKNAGVSIGDY 90  Pyrococcus hori...
Q58556        82 VKVKRVE-IKEAKKVVLAPTQPIRFGPGFEDFVKRKILGQVLSKGSKVTIG---------------VLGTa--------- 136 Methanocaldococ...
WP_010866329  85 VTVEKAEkVEPASKVVLAPTEPIRFGRDFVEYVKEFLLRKPISRGETIIVP---------------VLEG---------- 139 Aeropyrum pernix
WP_010884779  91 VTIRRAQ-VKEAKKVVLAPAQKGVIVQIPGDIIKNNLLGRPVVKGDIVVASgrgdlyyssgtpfdeIFRGffeamsvgfg 169 Pyrococcus hori...
Q58556       137 -LTFVVVSTTPAGPVRVTDFTHVELKEEPVSEIKET--KVPDVTYEDIGGLKEEVKKVREMIELPMRHPELFEKLGIEPP 213 Methanocaldococ...
WP_010866329 140 -LPLVVVSTQPAHFVYVTEATEVEIREKPVREEIERlrGVPKVTWEDIGDLEEAKERIREIVELPMKHPEIFKHLGIEPP 218 Aeropyrum pernix
WP_010884779 170 eLKFMVVNTIPKGIVQITYNTEVEVLPQAVEVREE---KIPEVTYEDIGGLKEAIQKIREMVELPLKHPELFERLGIEPP 246 Pyrococcus hori...
Q58556       214 KGVLLVGPPGTGKTLLAKAVANEAGANFYVINGPEIMSKYVGETEENLRKIFEEAEENAPSIIFIDEIDAIAPKRDEATG 293 Methanocaldococ...
WP_010866329 219 KGILLYGPPGTGKTLLAKALANEIGAYFISINGPEIMSKYYGESEQRLREIFKEAEENAPSIIFIDEIDAIAPKREEVTG 298 Aeropyrum pernix
WP_010884779 247 KGVLLYGPPGTGKTLLAKAVANEANAYFIAINGPEIMSKYYGESEERLREIFKEAEENAPAIIFIDEIDAIAPKREEVVG 326 Pyrococcus hori...
Q58556       294 EVERRLVAQLLTLMDGLKGRGQVVVIGATNRPNALDPALRRPGR-------------------------------FDREI 342 Methanocaldococ...
WP_010866329 299 EVEKRVVAQLLTLMDGLKERGRVIVIGATNRPDAIDPALRRPGR-------------------------------FDREI 347 Aeropyrum pernix
WP_010884779 327 EVEKRVVSQLLTLMDGLKGRGKVIVIGATNRPDALDPALRRPGRfdreievgvpdkqgrkeilqihtrgmpiepdFEKDA 406 Pyrococcus hori...
Q58556       343 VIGVP---DREGR----------------------KEILQ------IHTRNMPLAEDVDLDYLADVTHGFVGADLAALCK 391 Methanocaldococ...
WP_010866329 348 EIRPP---DKRAR----------------------AEILK------VHTRNMPLAEDVDLDKLAEMTHGYTGADLAALAK 396 Aeropyrum pernix
WP_010884779 407 VIKVLkdlEKDERfekekiekiiekvskansedeiKEILKedgnvyVEVRNRLI--DKLLEELAEVTHGFVGADLAALAR 484 Pyrococcus hori...
Q58556       392 EAAMRALRRVLP--SIDLEAEEIPKEVLDNLKVTMDDFKEALKDVEPSAMREVLVEVPNVKWEDIGGLEEVKQELREAVE 469 Methanocaldococ...
WP_010866329 397 EAAMAALRRFIRegKINFEAKEIPATVLKELKVTMKDFMEAMKMIRPTLIREIYVEVPEVRWSDIGGLEEAKQALREAVE 476 Aeropyrum pernix
WP_010884779 485 EAAMVVLRRLINegKINPEAESIPREVLEELKVTKRDFYEALKMVEPSALREVLIEVPNVHWDDIGGLEEVKQELREAVE 564 Pyrococcus hori...
Q58556       470 WPLKAKEVFEKIGVRPPKGVLLFGPPGTGKTLLAKAVANESGANFISVKGPEIFSKWVGESEKAIREIFRKARQSAPCII 549 Methanocaldococ...
WP_010866329 477 WPLKHPEIFEKMGIRPPRGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESERAIRKIFERARQAAPAVV 556 Aeropyrum pernix
WP_010884779 565 WPLKYPKAFKKLGITPPKGVLLYGPPGTGKTLLAKAVATESEANFIAVRGPEVLSKWVGESEKRIREIFRKARQAAPAII 644 Pyrococcus hori...
Q58556       550 FFDEIDAIAPKRGRDLSSA-VTDKVVNQLLTELDGMEEPKDVVVIAATNRPDIIDPALLRPGRLDRVILVPVPDEKARLD 628 Methanocaldococ...
WP_010866329 557 FFDEIDAIAPARGARFDTSgVTDRIVNQMLAEMDGIQPLSNVVVIGATNRPDILDPALLRPGRFDRLIYVPPPDKEARKE 636 Aeropyrum pernix
WP_010884779 645 FIDEIDAIAPARGTSEGEK-VTDRIINQLLTEMDGLVENSGVVVIAATNRPDILDPALLRPGRFDRLILVPAPDEEARFE 723 Pyrococcus hori...
Q58556       629 IFKIHTRSMNLAEDVNLEELAKKTEGYTGADIEALCREAAMLAVResigkpwdievklrelinylqsisgtfraaaveln 708 Methanocaldococ...
WP_010866329 637 IFKIHTKKVPLGEDVDLEKLAEMTEGYTGADIEAVVREAVMAKLR----------------------------------- 681 Aeropyrum pernix
WP_010884779 724 IFKVHTRSMPLADDVDLRELARRTEGYTGADIAAVCREAALNALRrvvk------------------------------- 772 Pyrococcus hori...
Q58556       709 svikatkeresaeagefselknaigkiisvlspakEKIEAVekeidkflevinkeelkpsekdeaqklakylkdilgklk 788 Methanocaldococ...
WP_010866329 682 -----------------------------------EKLEVG--------------------------------------- 687 Aeropyrum pernix
WP_010884779 773 -------------------------------svpkEKLEEEseef----------------------------------- 786 Pyrococcus hori...
Q58556       789 emidniyelenklntlkeqvsaeeideiikttqniiqrfttsldelknilkdiesirlkvstkdvKIKKEHFMKALEKIK 868 Methanocaldococ...
WP_010866329 688 -----------------------------------------------------------------KVEMRHFLEALKKVP 702 Aeropyrum pernix
WP_010884779 787 -------------------------------------------------------------lnklVVTRKDFEEALKKVK 805 Pyrococcus hori...
Q58556       869 PSVSKEDMRVYEKLAQEYGRAT 890 Methanocaldococcus jannaschii DSM 2661
WP_010866329 703 PSLTKEDILRYERLAKELKKLT 724 Aeropyrum pernix
WP_010884779 806 PSVSKYMMEYYRQFEEARKRVS 827 Pyrococcus horikoshii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap