Conserved Protein Domain Family
FAD_lactone_ox

?
TIGR01678: FAD_lactone_ox 
sugar 1,4-lactone oxidases
This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
Statistics
?
PSSM-Id: 273751
Aligned: 3 rows
Threshold Bit Score: 728.233
Threshold Setting Gi: 1703254
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P54783     9 NYVFKNWAGIYSAKPERYFQPSSIDEVVELVKSARLAEKSLVTVGSGHSPSNMCVTDEWLVNLDRLDKVQKFVEYpelhY 88  Saccharomyces cerev...
CAC21485  14 RVRFSNWAKTFSAISLGLRCPKTEEQLREILVDANSNGKKIRVVGAGHSPSDIVCTSGYLLSLDKMNKVVSFDPD----S 89  fission yeast
P10867     7 GVQFQNWAKTYGCSPEVYYQPTSVEEVREVLALAREQKKKVKVVGGGHSPSDIACTDGFMIHMGKMNRVLQVDKE----K 82  Norway rat
P54783    89 ADVTVDAGMRLYQLNEFLGAKGYSIQNLGSISEQSVAGIISTGSHGSSPYHGLISSQYVNLTIVNGKGELKFLDAENDPE 168 Saccharomyces cerev...
CAC21485  90 LSITVQAGIRFYQVQEILQNLGYSLPIVGSISETSVSGIMSTCTHGSSLQHQVLPHYIKSMRIMLADGSIVTCSRELQKD 169 fission yeast
P10867    83 KQITVEAGILLADLHPQLDEHGLAMSNLGAVSDVTVAGVIGSGTHNTGIKHGILATQVVALTLMTADGEVLECSESRNAD 162 Norway rat
P54783   169 VFKAALLSVGKIGIIVSATIRVVPGFNIKSTQEVITFENLLKQWDT--LWTSSEFIRVWWYPYTRKCVLWRGNKTT--DA 244 Saccharomyces cerev...
CAC21485 170 MFAAAQVSLGALGVIVDITISVVPAFDLVATEDVTTVTDLFQDWKNnlIWESAEFVRVHVFPYANRAVVWRANKVEpnTV 249 fission yeast
P10867   163 VFQAARVHLGCLGIILTVTLQCVPQFHLQETSFPSTLKEVLDNLDS--HLKRSEYFRFLWFPHTENVSIIYQDHTN--KA 238 Norway rat
P54783   245 QNGPAKSWWGTKLGRFFYETLLWIStKIYAPLTPFVEKFVFNRQYGklEKSSTGDVNVTDSISGFNMDCLFSQFVDEWGC 324 Saccharomyces cerev...
CAC21485 250 PHTPKPSLFRLKLDSFVYQCLLFVG-KCVNRVTPYLERFWFKCHYG--SKLGTALQVAGPGFDVLQMFCYFSQHVSEWGI 326 fission yeast
P10867   239 PSSASNWFWDYAIGFYLLEFLLWTS-TYLPCLVGWINRFFFWMLFN------CKKESSNLSHKIFTYECRFKQHVQDWAI 311 Norway rat
P54783   325 PMDNGLEVLRSLDHSIAQAAINKEFYVHVPMEVRCSNTTLPSEpldtskrtntspgpvygnvcrpfldntpshCRFAPLE 404 Saccharomyces cerev...
CAC21485 327 PLESAPDALEKLINYTVDDAGKIGAYTHWPIEVRVCAPTPEDE------------------------------CWLSTDC 376 fission yeast
P10867   312 PREKTKEALLELKAMLEAHPK---VVAHYPVEVRFTRG---DD------------------------------ILLSPCF 355 Norway rat
P54783   405 NVTnsqlTLYINATIYRPFGCNTPIHKWFTLFENTMMVAGGKPHWAKNFLgsttlaagpVKKDTDYDDfemrgmalkvee 484 Saccharomyces cerev...
CAC21485 377 KVP----TCYIEAIMYRPFSTSINYKPYFKALEDIANQYNGKPHWAKEYS---------LTKEQLLER------------ 431 fission yeast
P10867   356 QRD----SCYMNIIMYRPYGKDVPRLDYWLAYETIMKKFGGRPHWAKAHN----------CTQKDFEEm----------- 410 Norway rat
P54783   485 WygEDLKKFRKIRKEQDPDNVFLAN 509 Saccharomyces cerevisiae S288c
CAC21485 432 Y--PNLSKWLSLRKLLDPKGVFWND 454 fission yeast
P10867   411 Y--PTFHKFCDIREKLDPTGMFLNS 433 Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap