1Z7D


Conserved Protein Domain Family
Orn_aminotrans

?
TIGR01885: Orn_aminotrans 
Click on image for an interactive view with Cn3D
ornithine aminotransferase
This model describes the final step in the biosynthesis of ornithine from glutamate via the non-acetylated pathway. Ornithine amino transferase takes L-glutamate 5-semialdehyde and makes it into ornithine, which is used in the urea cycle, as well as in the biosynthesis of arginine. This model includes low-GC bacteria and eukaryotic species. The genes from two species are annotated as putative acetylornithine aminotransferases - one from Porphyromonas gingivalis (OMNI|PG1271), and the other from Staphylococcus aureus (OMNI|SA0170). After homology searching using BLAST it was determined that these two sequences were most closely related to ornithine aminotransferases. This model's seed includes one characterized hit, from Bacillus subtilis (SP|P38021).
Statistics
?
PSSM-Id: 273853
View PSSM: TIGR01885
Aligned: 16 rows
Threshold Bit Score: 718.337
Threshold Setting Gi: 46110845
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Z7D_A        29 PEDYINNELKYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNLTICSRAFFSVP 108 Plasmodium yoel...
XP_636989     13 SKELIEMESEFAAHTYHPIPVVFKKASGVHVWDVEEKQYFDFLSAYSAVNQGHSHPKIVSALITQAQKCALSSRAFYNEV 92  Dictyostelium d...
NP_001050753  39 SEELMRMERERSAHNYHPIPVVFSKGEGSHILDPEGNKYIDFLSAYSAVNQGHCHPKVLRALKEQAERLTLSSRAFYNDK 118 Japanese rice
Q9P7L5        13 TEQIEVLENEYAAHNYHPLPVCFSKAKGAKVWDPEGREYLDFLSAYSAVNQGHCHPKIIEALVEQAQRVTLSSRAFYNDK 92  Schizosaccharom...
P07991         8 SKQTIEWENKYSAHNYHPLPVVFHKAKGAHVWDPEGKLYLDFLSAYSAVNQGHCHPHIIKALTEQAQTLTLSSRAFHNDV 87  Saccharomyces c...
XP_385722     17 TDKAIAIEEEYAAHNYHPLPVVFSRAEGVNVWDPEGNHYYDFLSAYSAVNQGHCHPELIKTLTEQAGRLTLSSRAFYNDV 96  Fusarium gramin...
XP_382480     22 SQDALKAEQDHSAKNYQSLPIVFSRAQGASVWDPEGRHYLDFHAASTALNHGHCHPKLVATLVDQASRLTLTSRAFHNDI 101 Fusarium gramin...
XP_659414     18 TQEAIQAENDFAAHNYHPLPVVFARAQGTSVWDPEGRHYLDFLSAYSAVNQGHCHPKLVAALVDQASRLTLSSRAFYNDV 97  Aspergillus nid...
WP_005875102   7 AKYYVDLEHRYGAHNYHPLEVVLSRGQGAYVWDVDGKRYFDFLSAYSAVNQGHCHPKIIAALKEQAEKICLTSRAFYNDC 86  Porphyromonas g...
WP_011584050   8 SQQAIELEDKYGAHNYHPLPVVLAKGEGVHVWDVEGKHYYDFLSAYSAVNQGHCHPRIINALIEQAQTLTLTSRAFYNDK 87  Cytophaga hutch...
1Z7D_A       109 LGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWGYEVKKIPENMAKIVVCKNNFSGRTLGCISASTT-KKCTSNFG 187 Plasmodium yoel...
XP_636989     93 FPQYAKYITEYFGYEMVLPMNTGAEAVETSIKLARRWGYVKKGIAEDQAIVISCKGCFHGRTIGVISMSDD-PSSYNKYG 171 Dictyostelium d...
NP_001050753 119 FPIFAEYLTSMFGYEMMLPMNTGAEGVETAIKLVRKWGYEKKKIPKNEALIVSCCGCFHGRTLGVISMSCD-NDATRGFG 197 Japanese rice
Q9P7L5        93 FGPFAKYITEYFGYEMVIPMNTGAEAVETACKLARLWGYKAKKIPTDEAIILSCVDNFHGRTMGIISMSTD-PDARDNYG 171 Schizosaccharom...
P07991        88 YAQFAKFVTEFFGFETVLPMNTGAEAVETALKLARRWGYMKKNIPQDKAIILGAEGNFHGRTFGAISLSTDyEDSKLHFG 167 Saccharomyces c...
XP_385722     97 FPKWAEKVRSVFGYDMVLPMCTGAEAVETAIKIARKWAYKVKGVPQEKAWIFGVSENFHGRTMTAITLSVD-PESRENYG 175 Fusarium gramin...
XP_382480    102 YPQFARYVTGLFGYDRVLPSSTGAEASETAIKVARKWAYKVKGVPENQAIVFGAAGNHHGRTLATIALASD-NMSRDNYG 180 Fusarium gramin...
XP_659414     98 FPKFAEMVTKYFGFDMVLPMNTGAEAVETGIKIARKWGYKVKGIPENEAIILSAENNFHGRTMAAISLSSD-PESRENYG 176 Aspergillus nid...
WP_005875102  87 LGEYEEFMHHYFGYDKMLPMNSGAEAVETALKLSRRWGYRVKGIPEEKAVIIVCDGNFHGRTISIVSMSSD-PDSYTDYG 165 Porphyromonas g...
WP_011584050  88 LGEAEKFICDLFGYDKALLMNSGAEANESAIKLARKWGYQVKGIPTDQAVIVAVERNFHGRTTGIISASTD-PDSRNNFG 166 Cytophaga hutch...
1Z7D_A       188 PFAPQF--------SKVPYDDLEALEEELKD---PNVCAFIVEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQT 256 Plasmodium yoel...
XP_636989    172 PLMNGI--------IKIDYNSTQQLEEVLSQh-aDRVCGFIVEPIQGEAGVVVPDEGYLKKCYELCKKYNVLLVADEIQT 242 Dictyostelium d...
NP_001050753 198 PLVPGH--------LKVDFGDTDGLEKIFKDh-gERICGFLFEPIQGEAGVIIPPDGYLKAVRDLCSRHNILMIADEIQT 268 Japanese rice
Q9P7L5       172 PYLPNVgpkisgadRVLRYNNIEDLKYYLDTf-gPKVAAFLVEPIQGEAGVMVPDDGYLEEAYKLCKAHNVLFIADEVQT 250 Schizosaccharom...
P07991       168 PFVPNVasg--hsvHKIRYGHAEDFVPILESpegKNVAAIILEPIQGEAGIVVPPADYFPKVSALCRKHNVLLIVDEIQT 245 Saccharomyces c...
XP_385722    176 PYVPNVgainpttgKAIRYNNIADLEEVLEAh-gKETAAFICEPIQGEAGVVVPDDDYLAKVQALCTKHNVLFICDEIQT 254 Fusarium gramin...
XP_382480    181 PLDQNIsctipgtnRHIEYNNKAALDEAFEAa-gFNLAAFIVEPIQGDAGVIVADDDYLRHARSLCDKHNVLLICDEIQT 259 Fusarium gramin...
XP_659414    177 PYVPNIgctipgteKPITYNDKAALREAFEKa-gSNLAAFLVEPIQGEAGIIVPDDDYLQLARSLCDQHNVLLICDEIQT 255 Aspergillus nid...
WP_005875102 166 PYTPGF--------VNIPYNNIEALEKALEEh-kDHVAAFVVEPIQGEAGVFVPDDGYIRRAAELCRKYHALFVADEVQT 236 Porphyromonas g...
WP_011584050 167 PFMPGY--------QIIPYNDVIALEEALKN---PNVCGFWVEPIQGEAGVFVPGDGYLKKAQELCTKYNVILMMDEIQT 235 Cytophaga hutch...
1Z7D_A       257 GLGRTGKLLCVHHY--NVKPDVILLGKALSGGHYPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEALNVLINEKL 334 Plasmodium yoel...
XP_636989    243 GLCRTGRMLCSDWD--GIKPDLVLLGKAISGGLLPISAVLGGKDVMLTIKPGEHGSTYGGSPLASAVAMAALDVLRDENL 320 Dictyostelium d...
NP_001050753 269 GIARTGKMLACDWE--NIRPDVVILGKALGAGVVPVSAVLADKDIMLCIKPGEHGSTFGGNPLASAVAVASLKVVTDEGL 346 Japanese rice
Q9P7L5       251 GVARTGKMLCIEHS--NVKPDVVILGKAISGGVYPVSAVLSSREIMLNFEPGTHGSTYGGNPLGAAVSIAALEVVKEEKL 328 Schizosaccharom...
P07991       246 GIGRTGELLCYDHYkaEAKPDIVLLGKALSGGVLPVSCVLSSHDIMSCFTPGSHGSTFGGNPLASRVAIAALEVIRDEKL 325 Saccharomyces c...
XP_385722    255 GIGRTGRMLCSEWA--NIKPDLVTLGKAISGGMYPVSCVLSSKEVMLVVEPGTHGSTYGGNPLGSAVSIRALEIMEEEDL 332 Fusarium gramin...
XP_382480    260 GIGRTGKFLGHYWS--GIRPDMVLLGKTMTGGMYPFSCVLGDNAVMLTVEPGTHGSTYGGNPLGAAIAMRALQVVEEENL 337 Fusarium gramin...
XP_659414    256 GIARTGKLLCHEWS--GIKPDMVLLGKAISGGMYPVSCVLGRKDVMLTVEPGTHGSTYGGNPLACAVAIRALEVVQEENM 333 Aspergillus nid...
WP_005875102 237 GIARTGRMLCCDHD--DVRPDIVVLGKAISGGVLPVSCVLADDEVMLTIKPGEHGSTFGGFPLACKVAMAALTVVKEERL 314 Porphyromonas g...
WP_011584050 236 GCGRTGKLIASNHE--GVHPDMLILGKALSGGTYPVSCVLTSDEIMLTIKPGEHGSTFGGNPLACAVLVESLAVLMDEGL 313 Cytophaga hutch...
1Z7D_A       335 CENAEKLGGPFLENLKRE---LKDskIVRDVRGKGLLCAIEFKNEL---VNVLDICLKLKENGLITRDVHDKTIRLTPPL 408 Plasmodium yoel...
XP_636989    321 AENAQKLGEHFRAQISNI---NHP--AIQLVRGKGLLNAIVIDPNFt--VSAWDICIKFAENGLLAKPTHDNIIRLAPPL 393 Dictyostelium d...
NP_001050753 347 VERAAKLGQEFRDQLQKVqqrFPQ--IIREVRGRGLLNAVDLSNEAlspASAYDICIKLKERGVLAKPTHDTIIRLAPPL 424 Japanese rice
Q9P7L5       329 TERAAVLGEKFRTALIEC---KSP--IVQKVRGRGLLNAVVIDESKtngRTAWDLCLIMRSRGVLAKPTHGNIIRFSPPL 403 Schizosaccharom...
P07991       326 CQRAAQLGSSFIAQLKALqakSNG--IISEVRGMGLLTAIVIDPSKangKTAWDLCLLMKDHGLLAKPTHDHIIRLAPPL 403 Saccharomyces c...
XP_385722    333 TAKADKLGNMFRDGLKAL---NTP--ILKVIRGKGLLNAVVIDESAangRTAWDLCLLLKSKGLLAKPTHGDIIRFAPPL 407 Fusarium gramin...
XP_382480    338 AENAERLGCVMRDGLKEIq-aQTN--IIETVRGRGLLNAVVIDQSKtngHTGIGLCELMKEKGLLLKSSRTGIIRISPPL 414 Fusarium gramin...
XP_659414    334 VERAEKLGQAFRSGLEAI---QNP--IIQTVRGKGLLNAIVIDESKtngHTAWDLCMLMKEKGLLAKPTHQNIIRLAPPL 408 Aspergillus nid...
WP_005875102 315 PERAEELGQYFRGELLKI---KSP--LLKLVRGRGMLNAIVIEPHn--rHEAWDVCEAMAERGLLAKPTHRHIIRLAPPL 387 Porphyromonas g...
WP_011584050 314 IDNAASMGELFRDRMNAL---KDKceHVTLVRGKGLLNAIIIKPTAd-gRTAWDVCMKLMENGLLAKPTHGDIIRFAPPL 389 Cytophaga hutch...
1Z7D_A       409 CITKEQLDECTEIIVKTVK 427 Plasmodium yoelii yoelii
XP_636989    394 TITLEQIDQCVSIIKKVFD 412 Dictyostelium discoideum AX4
NP_001050753 425 SISPEELAEASKAFSDVLE 443 Japanese rice
Q9P7L5       404 VITEEDLMKGIEVIKKSLN 422 Schizosaccharomyces pombe 972h-
P07991       404 VISEEDLQTGVETIAKCID 422 Saccharomyces cerevisiae S288c
XP_385722    408 VISEEDLKKGLNIIAEAIK 426 Fusarium graminearum PH-1
XP_382480    415 VITVEEIHWSLRIMKESID 433 Fusarium graminearum PH-1
XP_659414    409 VITEEEIAKALEIIKAAVa 427 Aspergillus nidulans FGSC A4
WP_005875102 388 CITREELAQAVEIIKESIK 406 Porphyromonas gingivalis
WP_011584050 390 IITEEQINACCDIIEKTLL 408 Cytophaga hutchinsonii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap