3SFW,4CNS


Conserved Protein Domain Family
D-hydantoinase

?
TIGR02033: D-hydantoinase 
Click on image for an interactive view with Cn3D
D-hydantoinase
This model represents the D-hydantoinase (dihydropyrimidinase) which primarily converts 5,6-dihydrouracil to 3-ureidopropanoate but also acts on dihydrothymine and hydantoin. The enzyme is a metalloenzyme.
Statistics
?
PSSM-Id: 273937
View PSSM: TIGR02033
Aligned: 9 rows
Threshold Bit Score: 724.561
Threshold Setting Gi: 27351592
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3SFW_A         3 KWIRNGTVVTASDTYQADVLIDGEKVVAIGSDl-qATDA-EVIDATGYYLLPGGIDPHTHLDMPFGG--TVTSDNFFTGT 78  Brevibacillus agri
BAC48598       8 LIIRGGRVATTTDVFEADVAISGETIAAVGRG---LPAAkREIDARGKLVLPGGVDSHAHIEQLSAAg-IMNADTFESAT 83  Bradyrhizobium ...
AAO66292       3 KWIRNGTVVTASDTYQADVLIDGEKVVAIGSDl-qATDAe-VIDATGYYLLPGGIDPHTHLDMPFGG--TVTSDNFFTGT 78  Brevibacillus agri
AAO24771       4 KLLVGGTIVSSTGKIRADVLIENGKVAAVGMLdaaTPDTvERVDCDGKYVMPGGIDVHTHIDSPLMG--TTTADDFVSGT 81  Arthrobacter cr...
BAB44078      55 ILIRGGTVVNAHRVEEADVYVEDGVIVAVRPNipvGDDHvKVIDATGKYVMPGGIDPHTHLEMEFMG--TVTIDDFFSGH 132 Japanese rice
AAK64497      17 LLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNl-iVPGGvKTIEANGKMVMPGGIDVHTHFQMPYKG--MTTVDDFFQGT 93  Norway rat
WP_001264442   3 VLIKNGTVVNADGQAKQDLLIESGIVRQLGNNi-sPQLPyEEIDATGCYVFPGGVDVHTHFNIDVGI--ARSCDDFFTGT 79  Escherichia coli
4CNS_A         7 LLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNl-iVPGGvKTIEANGKMVIPGGIDVHTHYQMPYKG--MTTVDDFFQGT 83  human
WP_002387141   3 ILLKGGTVVSAYNRRQLDIRIDGEQIVEMGANl--PVENsQIEDVTGCYVLPGFIDAHTHLELNNGKgsLSTADNFTTGS 80  Enterococcus fa...
3SFW_A        79 KAAAFGGTTSIVD-FCLTSKGESLHSAIATWHEKARGKAVIDYGFHLMVSDANDHVLEELESVVNNEGITSLXVFMAYKN 157 Brevibacillus agri
BAC48598      84 VSAAFGGTTTVIP-FAAQHVGMKLPQVVEDYHALAKKGAVIDYAFHMIIADATRETVEEHIPALVKQGHASIKIFMTYDR 162 Bradyrhizobium ...
AAO66292      79 KAAAFGGTTSIVD-FCLTSKGESLHSAIATWHEKARGKAVIDYGFHLMVSDANDHVLEELESVVNNEGITSLKVFMAYKN 157 Brevibacillus agri
AAO24771      82 IAAATGGTTTIVD-FGQQLAGKNLLESADAHHKKAQGKSVIDYGFHMCVTNLYDN-FDSHMAELTQDGISSFKVFMAYRG 159 Arthrobacter cr...
BAB44078     133 AAALAGGTTMHID-FVIPVNG-NLTAGLESYKQKAEK-SAMDYGFHMAITKWNDDVSREMETMVKEHGINSFKFFMAYKG 209 Japanese rice
AAK64497      94 KAALAGGTTMIID-HVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLSKEKGVNSFMVYMAYKD 172 Norway rat
WP_001264442  80 RAAACGGTTTIIDhMGFGPNGCRLRHQLEVYRGYAAHKAVIDYSFHGVIQHINHAILDE-IPMIVEEGLSSFKLYLTYQY 158 Escherichia coli
4CNS_A        84 KAALAGGTTMIID-HVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKD 162 human
WP_002387141  81 QAAVAKGTTTVID-MATPNKGGSLKDCLATWNQLAEGKSSCDYTYHMSMIEWKPTIAAE-IQEMIAAGITSFKMYMAYDN 158 Enterococcus fa...
3SFW_A       158 VlMADDETLFKTLIRAKELGALVQVHAENGDVLDYLTKQALAEGNTDPIYHAYTRPPEAEGEATGRAIALTALA-DAQLY 236 Brevibacillus agri
BAC48598     163 L-KVDDEPLLDILLAARQSGAMLCAHAENHGIIAWMVKRLLARGYTLPKYHAVSHARVSEAEAFTRLIGMAALI-DQPIM 240 Bradyrhizobium ...
AAO66292     158 VlMADDETLFKTLIRAKELGALVQVHAENGDVLDYLTKQALAEGNTDPIYHAYTRPPEAEGEATGRAIALTALA-DAQLY 236 Brevibacillus agri
AAO24771     160 SlMINDGELFDILKGVGSSGAKLCVHAENGDVIDRIAADLYAQGKTGPGTHEIARPPESEVEAVSRAIKISRMA-EVPLY 238 Arthrobacter cr...
BAB44078     210 SlMVTDDLLLQGLQKCKSLGALAMVHAENGDAVAEGQQRMIDLGITGPEGHALSRPPVLEGEATARAIRLAKFV-NTPLY 288 Japanese rice
AAK64497     173 LyQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQARMLEMGITGPEGHVLSRPEELEAEAVFRAITVASQT-NCPLY 251 Norway rat
WP_001264442 159 Kl--NDDEVLQALRRLHESGALTTVHPENDAAIASKRAEFIAAGLTAPRYHALSRPLECEAEAIARMINLAQIAgNAPLY 236 Escherichia coli
4CNS_A       163 LyQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPEGHVLSRPEELEAEAVFRAITIASQT-NCPLY 241 human
WP_002387141 159 Lr-TTDAEIFEAMKEIKKVNGMLGVHCENGDLVDELIQSYVSQGKLTPHYHPLSRPAAVEAEAVARYLMIAEMA-DLPVN 236 Enterococcus fa...
3SFW_A       237 VVHVSCADAVRRIAEAREKGWNVYGETCPQYLVLDITALE-KPDFEGAKYVWSPPLR-EKWNQDVLWSALKNGILQTVGS 314 Brevibacillus agri
BAC48598     241 IFHVSTAEGAKVIRDSRGQGLKVFAETCPQYLFLTAADLD-KPGADGAKWMCSPPPR-THADQEALWQALSLGDLQTISS 318 Bradyrhizobium ...
AAO66292     237 VVHVSCADAVRRIAEAREKGWNVYGETCPQYLVLDITALE-KPDFEGAKYVWSPPLR-EKWNQDVLWSALKNGILQTVGS 314 Brevibacillus agri
AAO24771     239 FVHLSTQGAVEEVAAAQMTGWPISAETCTHYLSLSRDIYD-QPGFEPAKAVLTPPLR-TQEHQDALWRGINTGALSVVSS 316 Arthrobacter cr...
BAB44078     289 VVHVMSIDAMDEIAKAKREGQRVIGEPVVSGLVLDDSWLWdPDFMIASKYVMSPPIR-EAGHNKALQVALSSGILQLVGT 367 Japanese rice
AAK64497     252 VTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWsKNWAKAAAFVTSPPLSpDPTTPDYINSLLASGDLQLSGS 331 Norway rat
WP_001264442 237 IVHLSNGLGLDYLRLARANHQPVWVETCPQYLLLDERSYD---TEDGMKFILSPPLR-NVREQDKLWCGISDGAIDVVAT 312 Escherichia coli
4CNS_A       242 VTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWsKNWAKAAAFVTSPPLSpDPTTPDYINSLLASGDLQLSGS 321 human
WP_002387141 237 IVHLSTKRSLEAVERARQRGQSVYVETCPQYLLLDDHLYD-APNFEAAKYVCSPPLR-KREDQRALWQGIKEGAINTIST 314 Enterococcus fa...
3SFW_A       315 DHCPFNFSGQk---ELGRRDFTKIPNGGPIIEDRMTILFSEGVRKGKISLNQFVDITSTKVAKLFGMFPQKGTIAVGSDA 391 Brevibacillus agri
BAC48598     319 DHAPYRFDETgklrAGPNPNFKQVANGLPGLELRLPLLFDAMVSKGRLGLEKFVELTATAPAKIYNLHPRKGSIVVGADA 398 Bradyrhizobium ...
AAO66292     315 DHCPFNFSGQk---ELGRRDFTKIPNGGPIIEDRMTILFSEGVRKGKISLNQFVDITSTKVAKLFGMFPQKGTIAVGSDA 391 Brevibacillus agri
AAO24771     317 DHCPFCFEEKq---RMGADDFRQIPNGGPGVEHRMLVMYETGVAEGKMTIEKFVEVTAENPAKQFDMYPKKGTIAPGSDA 393 Arthrobacter cr...
BAB44078     368 DHCTFNSTQK----AFGSDDFRKIPNGVNGIEERMHIIWDSMVETGRISVSDYVRVTSTECAKIFNIYPRKGAILEGSDA 443 Japanese rice
AAK64497     332 AHCTFSTAQK----AIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDS 407 Norway rat
WP_001264442 313 DHCTFSMAQRl---QISKGDFSRCPNGLPGVENRMQLLFSSGVMTGRITPERFVELTSAMPARLFGLWPQKGLLAPGSDG 389 Escherichia coli
4CNS_A       322 AHCTFSTAQK----AIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDS 397 human
WP_002387141 315 DHCSFNFYGQk---TVGKDDFSKIPNGMPGVETRPELIYTEGVAKGRITLEKMVALLSENIAKQFSMYPQKGVVQEGSDA 391 Enterococcus fa...
3SFW_A       392 DIVLFDPTVQRTISVETHHMNVDYNPFEGMQVHGDVISVLSRGAFVVRNKQFVGHAGAGRYVKR 455 Brevibacillus agri
BAC48598     399 DIAIWDPNRETVIADEMMHDLAGYTPFAGRKVKGWPVSVLSRGRVIVEGNKCLASAGSGKFLAR 462 Bradyrhizobium diazoefficiens U...
AAO66292     392 DIVLFDPTVQRTISVETHHMNVDYNPFEGMQVHGDVISVLSRGAFVVRNKQFVGHAGAGRYVKR 455 Brevibacillus agri
AAO24771     394 DIIVVDPNGTTLISADTQKQNMDYTLFEGFKIRCSIDQVFSRGDLISVKGEYVGTRGRGEFIKR 457 Arthrobacter crystallopoietes
BAB44078     444 DIIILNPERSFVMGAHTHHSRSNTNVYEGRKGKGMVEVTISRGRVVWEDGILNVVPGSGRYVRT 507 Japanese rice
AAK64497     408 DLVIWDPDAVKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPC 471 Norway rat
WP_001264442 390 DVVIIDPRQSQQIQHRHLHDNADYSPWEGFTCQGAIVRTLSRGETIFCDGTFTGKAGRGRFLRR 453 Escherichia coli
4CNS_A       398 DLVIWDPDAVKIVSAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPC 461 human
WP_002387141 392 DLVVWDPRTTGVIAARTQLQNVDYTPYEGFETQGQARMVYLRGQKVAEAGQVILANQ-GKFVFR 454 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap