Conserved Protein Domain Family
SMC_prok_B

?
TIGR02168: SMC_prok_B 
chromosome segregation protein SMC, common bacterial type
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]
Statistics
?
PSSM-Id: 274008
View PSSM: TIGR02168
Aligned: 24 rows
Threshold Bit Score: 802.35
Threshold Setting Gi: 41817428
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE79072    2 RIKKIELIGFKSFKDRTVIHFD-AGITGIVGPNGCGKSNIVDALMWVMGDQSAKDLRASQMTDVIFGGAEGYAPLGMCEV 80   Bdellovibrio bact...
AAR34506    2 KIKRLDIVGFKSFVDKVSFDFQ-QGITGIVGPNGCGKSNVVDAIRWAMGEQSAKNLRGRSMEDIIFGGSEFRKPLGMAEV 80   Geobacter sulfurr...
AAN69856    2 RLKCIRLAGFKSFVDPTTVNFP-SNMAAVVGPNGCGKSNIIDAVRWVMGESSAKNLRGESMTDVIFNGSSGRKPVSQASI 80   Pseudomonas putid...
CAD66601    2 RLEKLKIAGFKSFVDPTTLPLP-GNLVGVVGPNGCGKSNVIDAVRWVMGESSARHLRGETMADVIFNGSSTRKPASQASV 80   Methylococcus cap...
AAN55914    2 RLKQIKLAGFKSFVDPTKIPFL-QALSAIIGPNGCGKSNVIDAVRWVLGESSAKHLRGDSMSDVIFNGSSARKPVSVAGV 80   Shewanella oneide...
CAD10419    2 RLTSIKLAGFKSFVDPTHFQVP-GQLVGVVGPNGCGKSNIIDAVRWVLGESRASELRGESMQDVIFNGSTARKPGSRASV 80   Burkholderia cepacia
CAD86196    2 RLTEIKLAGFKTFVDPAVVPVP-GNLVGIVGPNGCGKSNVIDAVRWVLGESRASALRGESLQDVIFNGSATRKPIGRASV 80   Nitrosomonas euro...
CAD66591    2 RLSAIILQGFKSFRESTRIQFN-ANPVVIIGPNGCGKSNTVDAVRWVLGESSARQLRGGTLSDVISNGGGSRPAASVATV 80   Acidithiobacillus...
AAK22360    2 QFQRLRLSGFKSFVEPTEFRIE-PGLTGIVGPNGCGKSNLLEALRWVMGANSAKAMRAGGMDDVIFAGSGARPARNHADV 80   Caulobacter cresc...
CAD66598    2 QITKLKIFGFKSFAQRTEINFPtKGLTAVVGPNGCGKSNITDAIRWVLGEQKAAALRMGKMQDVIFSGTEERAAMSLAEV 81   Fibrobacter succi...
CAE79072   81 SLTLENDGGPFPAkyIKHSEIMVTRRLHRNGEGEYFINKEPARLKDLQEIFMDTGAGSKGFSIIAQGMIGKIITAKPEDR 160  Bdellovibrio bact...
AAR34506   81 SMVFATDDGRVPAkyLSYSEIQITRRLYRDGESEYFLNKTPCRLMDITELFMDTGVGARAYSIIEQGKIGMILHSKPEER 160  Geobacter sulfurr...
AAN69856   81 ELVFDNSETTLVGeyAAYAEISIRRKVTRDGQNSYYLNGTKCRRRDITDIFLGTGLGPRSYSIIEQGMISKLIEAKPEEL 160  Pseudomonas putid...
CAD66601   81 ELVFDNSSGRAGGeyARYQQIAIRRQVARDGQSSYFLNGTRCRRKDITDLFLGTGLGARSYAIIEQGTISRLIEAKPEEM 160  Methylococcus cap...
AAN55914   81 ELVFENKEGRLAGqyASYEEISVKRQVSRDGESWYFLNGQKCRRKDITDLFMGTGLGPRSYAIIEQGTISRLIESKPQDL 160  Shewanella oneide...
CAD10419   81 ELVFDNADGRAAGqwGQYAEIAVKRVLTRDGTSSYYINNLPARRRDIQDIFLGTGLGPRAYAIIGQGMIARLIEAKPEEL 160  Burkholderia cepacia
CAD86196   81 ELVFDNSSGKAAGqwKSYSEIAIRRVIQRDGESSYYINNIHVRRRDITDMFLGTGVSGRGYAIIEQGMISRIIEARPQEL 160  Nitrosomonas euro...
CAD66591   81 ELRFDNSDGAAPGafAGAAEISVRRSLDRKGDGHYRINGARCRRRDVADLFLGTGLGGNAYAIVEQGTIGRIVDARPDDL 160  Acidithiobacillus...
AAK22360   81 TLTIDNADRTAPAqfNDDPILEVVRRIDRGEGSTYRINGREVRARDVQLLFADASTGANSPALVRQGQISELIGAKPQNR 160  Caulobacter cresc...
CAD66598   82 SIVIDNSDGTLAS---DYSEVIVTRRVHRDGSGEYLINNQECRLRDVHALLFDSGLGSSTYSQMNADMIKAVLSDKADDR 158  Fibrobacter succi...
CAE79072  161 RMLIEEAAGITKFKARKKESQRKLVATDQNLVRLQDIIGELKRQIDSLQRQAQRAERYRNIKNQIEDLDLWLSTAQYVEL 240  Bdellovibrio bact...
AAR34506  161 RFIIEEAAGVTKFKARKQVALKKIDLTRQNLLRIGDILSEIKRQLNSLQRQVKKAERFREYREELREIEIHASVRRFTAL 240  Geobacter sulfurr...
AAN69856  161 RNFIEEAAGISKYKERRRETENRIRRTQENLARLTDLREELERQLERLHRQAQAAEKYREYKAQERQLKARLSALRWRDL 240  Pseudomonas putid...
CAD66601  161 REIIEEAAGISKYKERRHETEQRMRHTRENLERLADLREELGRQLGHLQRQARKAEKFIALRDEERRLKLELLGLRWRAL 240  Methylococcus cap...
AAN55914  161 RTFIEEAAGISRYKERRRETESRIRHTRENLERLGDIRSELGKQLDKLSQQAKAATQYRELKQAERKTHAELLVMRFQEL 240  Shewanella oneide...
CAD10419  161 RVFLEEAAGVSKYKERRRETENRLHDTRENLTRVEDIVRELGANLEKLEAQAVVATRYKELQADGEEKQRLLWLLRKNEA 240  Burkholderia cepacia
CAD86196  161 RTFLEEAAGITRYHEKRHETGLRLADARGNLQRVDDILEELDKQQQHLEAQAECAVRYQDLHRQLTAAQHTLWTLHKQQA 240  Nitrosomonas euro...
CAD66591  161 RAILEEAGGISRYKERRRETTQRIAETREHLQRLYDIHGEMDGQWQRLQRQAESAQRLRALRVEERQWQWWSLALRVDAL 240  Acidithiobacillus...
AAK22360  161 RRILEEAAGVSGLHTRRHEAELRLRAAETNLSRLEDVARELETALNRLRREARQAEKYKRLSSEIRAVQGAVLYARWTEA 240  Caulobacter cresc...
CAD66598  159 RVLFEEAAGVSKYKQQRKETRRQLERVQMDMERVEDNLRSVRRSVRLYETQAEKVNAYKKLNTRLRELDLSVSLDKFEDY 238  Fibrobacter succi...
CAE79072  241 KRAADEAQAIFNEAQSMEVEGETNLSTLQGQLEVLKLQILEKEKAVEEQQTEYFTKQSTVQKKEMEIQELRFEIEQARRN 320  Bdellovibrio bact...
AAR34506  241 DAEKERIEGLLREAVSRESTLTADLERRDLELAEHRLALAEREKEVVTAQEGLFRQKADIQACESRIEFQRRELSSLERQ 320  Geobacter sulfurr...
AAN69856  241 DEQVRQRESVIGDQGVSHEALVAEQRNADASIERLRDGHHELSERFNQVQGRFYSVAGDIARVEQSIQHGQQRLRQLQDD 320  Pseudomonas putid...
CAD66601  241 ERQLDRLKAELTDSEERFRRLTGEEHACETQLEGLNRLRGVAQEKLDVQQGRFYELGAEISRLDQFIRHTQKSRAELVQE 320  Methylococcus cap...
AAN55914  241 QSQMASLSEQINSLELQQAAAQSLAQTSELESTELQVKLSQLAEQEQHAVEAYYLTGTEIAKLEQQLQSQKQRDAQLHTQ 320  Shewanella oneide...
CAD10419  241 GGEQERQQRAIEQAQIDLEAHTAKLREVEAQLETLRVAHYSASDAMQGAQGALYEANSEVSRLEAEIKFIVESRNRVQAQ 320  Burkholderia cepacia
CAD86196  241 AESRHQAQVEVERLVQEMETIRSGMQETGEKLDELRLYHRVVNDRQHQIQGALYAANGEIARIEQNIRHIRANREQLDRQ 320  Nitrosomonas euro...
CAD66591  241 EAERRQSLEQRSRLQDEYRREERLLDAVTQSLDQLRAEDRRMQEDIAAAQGELYAVQARQSDMEHQLREQQAALQRVQTS 320  Acidithiobacillus...
AAK22360  241 RDHLERTTSEATAAARLVEETARASAAAQVAITEAEAAMPPLREEATIAQAILGQLAIQKDRAEREAEAAAAEFERLSND 320  Caulobacter cresc...
CAD66598  239 KEGLATLDSTTKRMNHEVESSKTQATELQAKIEEKKLAISEDENTYRDLERNVQAATIALNDLNNNIMRLRDSMAALESS 318  Fibrobacter succi...
CAE79072  321 EQMTGTILQEQQARKELLARDKAALDEQVTEL--KEESESLSAAFAEKNEIFQNFNSRIGTVDEDLTTKRRELFAVGQTE 398  Bdellovibrio bact...
AAR34506  321 QERVAVELATAGSQLVAAEEEFARLVEQSGSF--AVEVAGEEESLQTREMELEEMTGAERELAAHLDEARRELFSLLSEI 398  Geobacter sulfurr...
AAN69856  321 FKEAERTRLETESHLGHDRTLLATLGEELAML--EPEQEMTLAAAEEAAAALEEAELGMHGWQEQWDSFNSRSAEPRRQA 398  Pseudomonas putid...
CAD66601  321 RERVEAELRKVESDRDDDRLRLEAVRAEAAEL--KGKLASLEQEVAEAVSVRQAAEAKLKTCREGWEALAGDRHRLEGQA 398  Methylococcus cap...
AAN55914  321 LEQLSEQLTQNKAKLDTYQASFHALEAELGQL--APQHELQQEMMDELQAQWEMSVSRSEAQTEVARTQASAVAQHKLQL 398  Shewanella oneide...
CAD10419  321 IAALNAQREQWQSQAQKAQDDLADAEEQLAVA--EEKATLVEDEAAAKHDAMPALEARWRDAQTELNAERGGIAQTEQAL 398  Burkholderia cepacia
CAD86196  321 LAEAELQLQNHEQQLNEVNENLTSWQDKLEQA--KNCHLSCKEEHIVEAGKLPQMESAAQADQVRLIGLREKLALARQNE 398  Nitrosomonas euro...
CAD66591  321 LDQGQAQQQKVRSEQICQAEDENQRQQRLQDL--AVRRQALSGEEDSARRLRREAERGLEKQDEERQNQQQALAEMRRKR 398  Acidithiobacillus...
AAK22360  321 LSRIDADRAREAQAKDDAAAALARIAPELEEV--RALVAAAPERGPELAAVAKAAEEARAAAEAAVEQLAARVAAEEAQG 398  Caulobacter cresc...
CAD66598  319 NEKAQGEIERSEQKSQELSEEKARLEEEIAVLgsENDMDELNALLERERETLQVMRDKVDDLRTQSRELSNARLQATNRV 398  Fibrobacter succi...
CAE79072  399 SSLDARVNSLSSQIADLTDRQDNEQQVLNELREKQVefENRRKKVITELDKERQMQLDLASDVDSFEANKKILQDSVATK 478  Bdellovibrio bact...
AAR34506  399 AQLNNQRTAAVRRLEGLAERADRNRREGTLLQERLVeaTGKVHELDGTVSGLGRTKAELQERLPVVIRREEEIRQRLAEA 478  Geobacter sulfurr...
AAN69856  399 EVQQARLQQLETSLERQAERQRKLVEEREQLGSDPQ--DAAMLELAEQLASSEMLLEELQLCEEQVIERLESAREQLQQA 476  Pseudomonas putid...
CAD66601  399 ALQRSRLQQLREHGQQLGGRRQRLLQQQSELEKALA--ALDVQAHRLEVAGIEAEREETVGAVEALAREAERQRDRLRFA 476  Methylococcus cap...
AAN55914  399 ELHRSKL----VHQQQLNAHKTQLHQEQQQELSSLT--EHALEDTSASLSQEIELLEQVITQQIEVNQELELA---LVEN 469  Shewanella oneide...
CAD10419  399 KLEAAHQRNADQQLQQLQARHERLKSEAGGL-DAPD--EAQLEDLRMQLAEHEEILHDAQTRLADAQETLPRLDGERRAA 475  Burkholderia cepacia
CAD86196  399 KLLQNQQAYAEKTLHQLVVRRERLLEEQSSQ-PEID--PVQLDELQMESAELAAMLEQKQHSLSTLETQAYTVQQERDAI 475  Nitrosomonas euro...
CAD66591  399 DVTMAQIRELEPRLEDIERRLQRQSANIPSE-------RAAMQALAARCGTTETVLAEAASELRAHREALETLQNRIAVL 471  Acidithiobacillus...
AAK22360  399 RAAAARLSEAEARANRTNRALEQARAERAAVG-----------------PEVDPAAADARQRFANAEAALAAARAALEEA 461  Caulobacter cresc...
CAD66598  399 NSLRGRFERMDAEVNMLQSNIAKWQTEIEGLDKQKSdaEANIAEIQAGIEDTNREIENLEEQRATREERLESERAELTEA 478  Fibrobacter succi...
CAE79072  479 KAEVDSFKDSLNEVASRLYGLENLQNNFEGFQEGVKQVMLWQKtrtqemMADgsvvsHFQPVSEVVEVPAEYEVAMEAAL 558  Bdellovibrio bact...
AAR34506  479 EREFVTRRDELSRAASRLHSLQELESQFAGYGQGVRNLFLSER------FAGr----FGGVLADAVETGADYETALEAVC 548  Geobacter sulfurr...
AAN69856  477 TQAQQQAQGDLQRLGGRLASLEALQQAALEPG-AGAAQWLHGQg-----LEQ------QPRLAEGLRVEPGWELAVETVL 544  Pseudomonas putid...
CAD66601  477 RERLNPARAGLHAVQGKVASLETLQRHAMGRDRSAAAAVLEAWq-----LSA------ADRLGEKIEVAPGWENAVETVL 545  Methylococcus cap...
AAN55914  470 TQALDLARGEFEQLSQRLTSMRARFELVEQ-------WLAKQEe-----LSD------KPQLWQSIQVENGWEAAAELAL 531  Shewanella oneide...
CAD10419  476 QERVQAESSQIHQLDARLAALKQLQENVQTEG--KIQPWLEKHe-----LNG------LPRLWKKLHVEAGWEAALEAVL 542  Burkholderia cepacia
CAD86196  476 LQIIQSLERDMARANARCDVLQRLQDQIEDNQ--ELNAWMARLq-----LNL------LPRLWQQISIESGWETALEAVL 542  Nitrosomonas euro...
CAD66591  472 RNARDDTRAKAQEYGARQKALEGLLQRLQKP--------QAQNd-----PAG-------SRLVDQMRVQPGWERALEEVL 531  Acidithiobacillus...
AAK22360  462 ETARVKAAEQEAQARQLARSVEDQLGRLRTEARGLAQLTAPRSk------SG------HAPALDSVSPDKGYGAALAAAL 529  Caulobacter cresc...
CAD66598  479 QQKLQGLKNEEARLQSRIDVLQSVMNEGSDANRYLKENKANLIg---------------GLVSERIEATPEYASSVEAAL 543  Fibrobacter succi...
CAE79072  559 GSRLQMLLSSDANIAVDAVSHLKENKSGRSSFMAAdg----qGLTFNRAEAPMGqdgvQAILKDVVQAADKFKNTVTYML 634  Bdellovibrio bact...
AAR34506  549 AERLQYVLSESDEAALDAIAHLKESGGGRCGIIVA-------GIPADDRSSVTG----ATPLLDRVSIAAAWRPLIEPLL 617  Geobacter sulfurr...
AAN69856  545 GADLQAVLVDDFN--DLDFAGLEQGE--LRLLLAVga---gaTLPGS----L------------LEK--VEGRIDLAPWL 599  Pseudomonas putid...
CAD66601  546 GAHLEAVCVDSLAPYLANLQAQEPAE--FLALCEYrq---gpVAEGTGGPRL------------LDY--IRAPLALEGLL 606  Methylococcus cap...
AAN55914  532 QGLMTLPVGVSAN--ELGFYTDAR--------CLEki---ddHIEGS-----------------PIK--LPADVNLAPWL 579  Shewanella oneide...
CAD10419  543 RERLAALEVSNLD-WVKAFATDAPPA--KLAFYAPpv---agQPAATPPALRp-----LLSLVRIDD--AGIRAVLNDWL 609  Burkholderia cepacia
CAD86196  543 RERIQAVTVDRLE-QMLEWEAQRPSA--KWAVCELvp----dRPVSNDTDQRTWk--pLSTLLSCRS--PAVQAVLGNWL 611  Nitrosomonas euro...
CAD66591  532 GERLNALVMEGNN--MVTQGSMLWVS--TVMPAELps---dtLLQVLEMP-------------------ESLTLGLSDWL 585  Acidithiobacillus...
AAK22360  530 GDDLDAALDPKAPSYWGGAEAPAP------VWPEGa------EPLAPL---------------------VKAPPALAARL 576  Caulobacter cresc...
CAD66598  544 GEILDSVVVNGDSAVNEIVDALKSENVGKVLMSLVssaapayDKPVNNpc-------vVGSLKDFVKTDDEVSPWLSGIL 616  Fibrobacter succi...
CAE79072  635 DGVAIVDSIRTALNLRPRYEG-WTFVTLDGDTLTADGVLTGGSSEsADSGMLKRRR-----EIKELSEKKDEFAGKLQLA 708  Bdellovibrio bact...
AAR34506  618 ADVHLADTLAQALSLSRQYPR-ATFVTLQGDLAFGGGIVNGGSAEnAGQGLVHKKR-----EIRELSGTVERLESAVRET 691  Geobacter sulfurr...
AAN69856  600 GQVRPVEDLAQALEQRGSLGEgQSLVSRDGYWVGRHFLRVRRGGE-AEGGVLARGQ-----EIERLGQEQLEQEAALEQL 673  Pseudomonas putid...
CAD66601  607 AGIYCASDPAEAAERARSLQPhESVVTPGGFRIGKGWVLAQKPDA-GHAGALARER-----ELRECRRRVEELEAQCRIL 680  Methylococcus cap...
AAN55914  580 NGLKWADNLASAQAQLASLAAdERIVTADGYLLGKGFLIAKQDNS-QSLVQLSKEQtqlseAIAECVQARAIQQSKLDEL 658  Shewanella oneide...
CAD10419  610 GLSFVADDLQQALAMRSQLPEgGSFVVKAGHVVTRVGVQLYAADS-EQAGMLARQQ-----EIENLARQVRAQALLADEA 683  Burkholderia cepacia
CAD86196  612 YGVFVTDSLTAALADRSLLTSgEMLVTAEGHSITSCGVSYFAPDS-AVHGILQRQR-----EIAQIREECEQIGQSVLSQ 685  Nitrosomonas euro...
CAD66591  586 WGLRMAPDLASALDQRHQLRAgEAWITPQGVLVHRSGVAYPEHED-GASLLQCRR------ELAENWECFQRAQADAAAA 658  Acidithiobacillus...
AAK22360  577 SHVAVVTR-ANGDRLQKELKPgMRLVSKDGDLWRWDGFVARADAPrPAAVRLEQRT-----RLAEVEAEIDVMAPRAEAT 650  Caulobacter cresc...
CAD66598  617 SRYFVVDSLQTALNLAKEYRGeNLNFVTADTIVRTSGLVSFGVS---TSGALSRKN-----EIADAEALLEKVQGDISAG 688  Fibrobacter succi...
CAE79072  709 QMALKKTEEQLANVLNDFEGAQKRKIDQEIKVAELRKDAERAENEVQNALAAVERQEREVKKLTEQLEVQEQKLEELNEA 788  Bdellovibrio bact...
AAR34506  692 ETRREELRGERSRLEEEVRDLRQILHQTEIQFVNAEKDLQRAREECQRIEERIAIAGIEDEQLQDERRTLDEEIADADGR 771  Geobacter sulfurr...
AAN69856  674 DQQLQALREQQLDLEEQREQLRRRTQDENRLHGELKASLSASRARAEQVELRRRRLQEELSELEEQRALEHEQLGEARLL 753  Pseudomonas putid...
CAD66601  681 EREASEAEVELERLESEGREARKKADELSAGLSLARSELAAAEARSEQWRHRLDQLSHELNELADQELELAEKRAEAEEA 760  Methylococcus cap...
AAN55914  659 SQQLIQVRDSVNQGTQRLHQLQLDKATKSTQLNNAEALAKQREAKRGQLEDTVARTHAELAELAGQLMLLAEQEDELADA 738  Shewanella oneide...
CAD10419  684 KAAAIRAEAAHTQAAQALTDVRQQAERATQRVHALQMDVLKLTQAHERYTQRSTQIREELAEITAQIEEQRAMRAESEAN 763  Burkholderia cepacia
CAD86196  686 QQTLAAVEQDDQQIAADIVQLRKVIEEIRTQQHDRQIQIVRLTQQIERVAQQQAQLEIELADLAVQIEEESSQKQQAETE 765  Nitrosomonas euro...
CAD66591  659 HAALIAAEQQARTLQEQVRTADARWQDMSRQSARERESLARLRSRVETEEQQRAERAAESQRLDVERNALETRLHGLRQE 738  Acidithiobacillus...
AAK22360  651 TIALKAAADRLRAAEDLLRDKRRGPPDaERLLTQAREQVAKFEREQALRAARAQSLDDTIGRFEAEKVEADAALGEAR-E 729  Caulobacter cresc...
CAD66598  689 EENVDRLRELTEEDTQMLSSLVDEIREKRDSLRGGDASIRIHRNTVENCTRRLTQLNGDVTNAQNRIEAAAQ--SKNSDA 766  Fibrobacter succi...
CAE79072  789 L-IEARERKVLLETEVETLNSEMNSVRLGFDGLQAEVT-DLQVKSASKTQEYTGVLRQLEMVTKSLTDLEAQLARMSEEA 866  Bdellovibrio bact...
AAR34506  772 R-AEREAKREALDAEVARTQEALTVSRRTIEAARDAVT-ALKVKGAQLREKREAASRATVRTEESIRDLRERIGRLRGEG 849  Geobacter sulfurr...
AAN69856  754 L-QEALELMAQDTEQREQLMARRDTLRESLDRVRQEAR-QHKDHAHQLAVRLGSLRAQHDSTRQALERLEQQAARLTERQ 831  Pseudomonas putid...
CAD66601  761 L-QTAERDSLRLQDVAAQRKGEWLALEEAFAAAEAAEK-SLHEEVRALRSRAAMLESNAALTAAHLQRLEQQHGQTADRL 838  Methylococcus cap...
AAN55914  739 L-AQSIDKQQQQSQDAQGDLARHQALKAQISDTQRRLS-TLNASLQSVTTRMAVSTEQIELQRVRVNELVQSRETLSAQL 816  Shewanella oneide...
CAD10419  764 F-ERHDGELAELQARFEDHQLAFEALDEELTAARGQAR-DLDRAATDARFAARNMANRIDELKRSIQVAHEQSERVAASL 841  Burkholderia cepacia
CAD86196  766 L-VVCEAERVELEAQVNQAESACQSSGRALASQRSRVQ-RLSDRLHETAFGEQDCQNRVIDCERRIGMITRNSVILTENM 843  Nitrosomonas euro...
CAD66591  739 L-AADESGWQALEQVVLDSQRRTDTLRRRVDELRGIHG-RVRGEYQTLELRQQRLQAESEAAITRAEDLQQQWDQLAATV 816  Acidithiobacillus...
AAK22360  730 A-HAAAQTSGDLQPQLAEARQAAAQAREAAGAARTALDvETRERAGRQR-RLESLERDRADWSKRAEAAAKRAESLEGDR 807  Caulobacter cresc...
CAD66598  767 ElAEAEAEVEKVEERYQTISDQLGENETMLREKEEDVR-ELERSAQDKTSRLKQNQNRVVAIADQMEFLDNTIRNRREEI 845  Fibrobacter succi...
CAE79072  867 EGYNSQMTDTQVTLEEKKIEFERLLDEVETLKLQAARAKDEYEVMSESIRAIEDEASASQRARNERQHKMNDSQLKLEQA 946  Bdellovibrio bact...
AAR34506  850 ESSAAEREHLAVAITAAEDDLKGHLAAYAEAETLSRSLRSEFDARVEAVRVEETGLRELRHQCEAARDEVAAHKLTLSGL 929  Geobacter sulfurr...
AAN69856  832 EQLSLNLEEGEAPQEELRLKLEELLERRMSVDEEMRLARLHMDEADRELRDAEKRRTQAEQQAQLLRGQLEQLRLECQGL 911  Pseudomonas putid...
CAD66601  839 AAIVQRLAESQTPLEDERSRLDALTEERGVLEAEMARQRRRLSELEADVRRVAGERQRAEHELAALRESIGQMKLAWQTA 918  Methylococcus cap...
AAN55914  817 ASVAELHGDQQT--AKLSEQLALLLNQQQSQQQALKALRTQQSSLTETLNSIGLKQKQELGKLEGLTQSLSTLKLRREGL 894  Shewanella oneide...
CAD10419  842 EDARAELETINEQ--TAHTGLQDALDIRAVKEEALHAARLELDDLTAKLRAADETRLTAERALQPLRDRINELQLKEQAA 919  Burkholderia cepacia
CAD86196  844 QRLQHARADLDES--TLTADTVHWQIQRDQHEQALMAVRHELENMDDTLREMEQARMYAEQRLQECGEAVGQARLREQEA 921  Nitrosomonas euro...
CAD66591  817 AENEGELLRLQAALPEMLKARDAVGALRAGRSVHLEVLQSAAQTAGQQIREHESQRHALDKGLRALQKSEAAVEQQLAGL 896  Acidithiobacillus...
AAK22360  808 VKAAAALEAAREAPAALQEKLVALLDEFAAAEARRAKASDALETAETTRLNADRAARAAEQAAGEAREKRAALVAHLDGA 887  Caulobacter cresc...
CAD66598  846 EKNTVSIEKFETDCNKLADEAQVKDNALRELERNRDLARERYDLVSGDLEGWRDEVNRLRDDMIEKMKELNDVGRRQESL 925  Fibrobacter succi...
CAE79072  947 KMKEQYLIDQVRERYMLNLPDVVEKYV--N--REGDFLE-ADAQLKDLREKLAKIGEVNLSAIEEYEETAQRYEFLTKQH 1021 Bdellovibrio bact...
AAR34506  930 TLELNHLISSLADKYRLEMREVMPSYA--D--RPFDEEA-AARRQAELGRLIDEIGEVNLTAIEEYRELEERFAFLSSQK 1004 Geobacter sulfurr...
AAN69856  912 DVRRKTLQEQLLADGYDLQGVLATLEA------EASEQG-TEQELEQLEARIQRLGAINLAAIEEYEQQSERKRYLDAQD 984  Pseudomonas putid...
CAD66601  919 EVRRQGIEEQFAELGAAPAAVVAGLPE------DAEESA-WQASVIRLGEEIERLGPVNLTAMQEYQEQEARQRYLEEQD 991  Methylococcus cap...
AAN55914  895 KGQADSQLAALSEQQIVLAQIIDSLPS------DGQPDK-WQRDLDQIRQKIIRLGAINLAAIEEFEQQSERKSYLDHQD 967  Shewanella oneide...
CAD10419  920 RLNGEQFIEQLAAAGVDEAQLQAKLTP------DMKPSY-LQGEVTRINNAITALGPVNMAALDELKAATERKSFLDAQS 992  Burkholderia cepacia
CAD86196  922 EMTEARFADKLAESGETMLEMVPQFVN------ES-PAK-LQTRINRLTGEVTALGPVNLAALQELEALKSRRIHLEEQS 993  Nitrosomonas euro...
CAD66591  897 QARLDELQQRAAVLAQDLGDDPGPCPD------AT--R--CEESLTRIGAAIASLGNVNLAAEDELRELEGRRGNLLAQV 966  Acidithiobacillus...
AAK22360  888 RQRFAEVASAIREQARMEPEELGRHVAgeAvaVPKDAAG-VEAHLFALERERDAIGPVNLRAEEEAQEYAGRLETMRSER 966  Caulobacter cresc...
CAD66598  926 QNNLDRLRERITNEWSVDLDNPENVER------VEYTQPeADREIRELRGKIKELGPININVMEDYEDEKKRLEEVEKQF 999  Fibrobacter succi...
CAE79072 1022 ADLTEAKDQLRKVIERINKICSKRFKETFELVNDRFTRVFPVLFGGGEAWLELV-EETEK------NEAGIEIIARPPGK 1094 Bdellovibrio bact...
AAR34506 1005 DDLEESLQSLQQAIQRINRTTRKRFLETFTLVNEKFQEVFPRLFCGGRAELRLT-NEEDL------LETGIDIIVQPPGK 1077 Geobacter sulfurr...
AAN69856  985 ADLVEALETLENVIRKIDKETRNRFKDTFDQINAGLQALFPKVFGGGSAYLELT--GEDL------LDTGVTIMARPPGK 1056 Pseudomonas putid...
CAD66601  992 RDLTESLATLEQAIEKIDRECRARFKETFEKINAGFQRMFPKLFGGGKAALELT--ENNL------LSAGVSVMAQPPGK 1063 Methylococcus cap...
AAN55914  968 EDLNKGLATLEEAIRKIDKETRTRFKATFDAVNEDLGRLFPKVFGGGRAYLALT--EDDL------LETGVTIMAQPPGK 1039 Shewanella oneide...
CAD10419  993 TDLNSAIETLEDAIRKIDAETRTLLQGTFDQVNQHFGELFPRLFGGGQAKLIMT--GDEI------LDAGVQVMAQPPGK 1064 Burkholderia cepacia
CAD86196  994 HDLREAITTLEQAIRQIDRETRERLQETFDQVNQNLAGLFASIFGGGVAELVLS--GEDI------LDAGVQLNAHPPGK 1065 Nitrosomonas euro...
CAD66591  967 EDVESALYRLAEAMAAMDLETTVRFRDTLDKVNQALQELFAVLFGGGQAQLSLV--GEDV------LEAGLVLRAQPPGK 1038 Acidithiobacillus...
AAK22360  967 ADLSGAVTKLRAGIEELNAEGRERLLAAFDVINANFQTLFQALFGGGQAELKLI-ESDDP------LEAGLEIFACPPGK 1039 Caulobacter cresc...
CAD66598 1000 DDLDRARASLDRTITKLDDIARQRYLDTFARIQKNFQFVFSKLFLNGETKMNLVeRVDEMgkpmdiLDADIEINVRPTGK 1079 Fibrobacter succi...
CAE79072 1095 KTQNVSLMSGGEKALTAVALVFSIFLVKPSPWCLLDEVDAPLDDANVFRFNDLVREMAKRSQ--IIVVTHNKHTMEVAGK 1172 Bdellovibrio bact...
AAR34506 1078 KLQNVTLLSGGEKALTAVALIFSIFLIKPTPFCLLDEVDAPLDDANIGRFNDMVREMSDVSQ--FIIITHNKATMAVADT 1155 Geobacter sulfurr...
AAN69856 1057 KNSTIHLLSGGEKALTALALVFAIFKLNPAPFCMLDEVDAPLDDANVGRYARLVKEMSESVQ--FIYITHNKIAMEMADQ 1134 Pseudomonas putid...
CAD66601 1064 RNSSIHLLSGGEKALTAAALVFAIFELNPAPFCLLDEVDAPLDDANVGRFSQLVKEMSEKVQ--FLFITHNKATMEIAQY 1141 Methylococcus cap...
AAN55914 1040 KNSTIHLLSGGEKALTALSLVFAIFRLNPAPFCMLDEVDAPLDDANVERFCRLLKEMSQSVQ--FIYISHNKITMEMADQ 1117 Shewanella oneide...
CAD10419 1065 KNSTIHLLSGGEKALTATALVFAMFQLNPAPFCLLDEVDAPLDDANTERFANLVRAMSDKTQ--FLFISHNKIAMEMAQQ 1142 Burkholderia cepacia
CAD86196 1066 RNSSIHLLSGGEKALTALALVFSLFRLNPAPFCLLDEVDAPLDDSNSVRFCELVKRMSGETQ--FLFISHNKITMQMAQQ 1143 Nitrosomonas euro...
CAD66591 1039 RNATLQQLSGGEKALTAIALVFALFHLNPAPFCILDEVDAPLDDANVGRFCHLVQKMAAQTQ--FLIVTHRSLTMQVAEQ 1116 Acidithiobacillus...
AAK22360 1040 RMASMSLMSGGEQALTASALIFGVFLANPAPICVLDEVDAPLDDANVDRYCNMLDEMRRRTQtrFIAITHNPVTMSRMDR 1119 Caulobacter cresc...
CAD66598 1080 KMRGIKALSGGEHALTATALLFAIYMEKPSPYCVLDEVDGPLDDANVGRFMALLREFSKQTL--FIVVTHNKRTMAEADM 1157 Fibrobacter succi...
CAE79072 1173 LYGVTMQERGVSTMVSVSI 1191 Bdellovibrio bacteriovorus HD100
AAR34506 1156 LYGVTMEEPGVSKSVSVKL 1174 Geobacter sulfurreducens PCA
AAN69856 1135 LMGVTMHEPGCSRLVAVDV 1153 Pseudomonas putida KT2440
CAD66601 1142 LAGVTMREPGVSRIVTVDI 1160 Methylococcus capsulatus
AAN55914 1118 LIGVTMHEPGVSRIVAVDL 1136 Shewanella oneidensis MR-1
CAD10419 1143 LIGVTMQEQGVSRIVAVDM 1161 Burkholderia cepacia
CAD86196 1144 LIGVTMREQGVSRVVTVDI 1162 Nitrosomonas europaea ATCC 19718
CAD66591 1117 LVGVTMTEPGVSRVVRVDV 1135 Acidithiobacillus ferrooxidans
AAK22360 1120 LFGVTMAERGVSQLVSVDL 1138 Caulobacter crescentus CB15
CAD66598 1158 LYGVTQEIKGISRIASVQL 1176 Fibrobacter succinogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap