Conserved Protein Domain Family
SMC_prok_A

?
TIGR02169: SMC_prok_A 
chromosome segregation protein SMC, primarily archaeal type
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]
Statistics
?
PSSM-Id: 274009
View PSSM: TIGR02169
Aligned: 9 rows
Threshold Bit Score: 1043.88
Threshold Setting Gi: 499182836
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM07677        2 YIKEIEFVNFKSFG-KKVKISFYNDFTTISGPNGSGKSNIIDGILFALGLTS-SRTLRAEKLTDLIYN-----GDEAKKP 74   Methanosarcin...
AAL81967      117 YIEKLELKGFKSYGnKKVVIPFSKGFTAIVGANGSGKSNIGDAILFVLGGLS-AKAMRASRISDLIFAg----SKNEPPA 191  Pyrococcus fu...
BAC09477        2 YIKRLELTNFKSFG-GTTVIPLLPGFTVISGPNGSGKSNLLDALLFALGLAG-SKGMRAERLPDLVNHs---qTRRGHSV 76   Thermosynecho...
BAC91263        2 HLKCLEIERFKSFG-PYTRIPLLEGFTVVSGPNGSGKSNIIDALLFALGLST-SRGMRAEKLSDLIHQg---aAKG---- 72   Gloeobacter v...
CAC11918        4 YIERIEAHNFKSFR-RKKVINFTKGLNVISGPNGSGKSNIGDMLLFVLGTKS-IHAVRADRLSDLVSKg---------SG 72   Thermoplasma ...
BAB59963        4 YIERIEAYNFKSFR-KKKTIYFSRGLNVISGPNGSGKSNIGDMLLFVLGTKS-IHSVRADKLSDLISKd---------SG 72   Thermoplasma ...
WP_010879055    2 HIEKIRLKNFKSFG-KKAEIPFFKGFTVITGPNGSGKSNIIDSILFCLGLSTsTKQLRAERLTDLVHNg--------RS- 71   Archaeoglobus...
WP_010902208    2 YIEELVVENFKSFA-GTTRIPFYEDFTTISGPNGSGKSNIIDAILFALGLAR-TTGMRAETLTDLIYNpahegADGAAGP 79   Halobacterium...
WP_010880376    6 YIEKIVVEGFKSYGtKRKEIPLGEGFIAVVGPNGAGKSNIGDAISFALGLSS-AKALRAKNLSYLIFS------KNGQKA 78   Aquifex aeolicus
AAM07677       75 DFAQVTIRFDNTDRKLPle-------------lDEIVVSRKVRRTKSAYy-SYFYFNGKAVSLGEIHSQLSKAGVTPEGY 140  Methanosarcin...
AAL81967      192 KYAEVAIYFNNEDRGFPi---------------DEDEVVIRRRVYPDGR--SSYWLNGRRATRSEILDILTAAMISPDGY 254  Pyrococcus fu...
BAC09477       77 VETRVTVTFALDAET-------------------EWRVTRRLRVTKQGSytSTYAVNDQPCTLNELHDQLQAFCIYPQGY 137  Thermosynecho...
BAC91263       73 -EVAVTVTFALDAAAGG----------------GELTVCRRLKVNGPNSt-SSYQLNGSPCTLTDLHEELARHHIYPEGY 134  Gloeobacter v...
CAC11918       73 NECSVSVTFRSDDGR-------------------SLVIERRLVIEDEPK--SYYYVNGVRSRLSEIDETLASMGINFGTY 131  Thermoplasma ...
BAB59963       73 NTCYVIVTFKNDEGK-------------------SLEISRRLVIEDEPK--SYYYVNGTKARQSDVEDALSAFGINFGTY 131  Thermoplasma ...
WP_010879055   72 -EAEVAILFSENGKK--------------------YEIARKVKITEKGYy-SYYYLNGKSVSLSEIHSFLSQFGIYSDAY 129  Archaeoglobus...
WP_010902208   80 TEASVEVVLNNDAGVVSrsqvttaagsenvgsvDTITIKRRVKRTDDSHy-SYYYLNDRSVNLADIQELLAQAGIAPEGY 158  Halobacterium...
WP_010880376   79 DHAYVEVHFKNLG-AFPv---------------EDEEVVISRKVSKDGR--SIFKINGQVVRERDLKDFLAKAGIYETAY 140  Aquifex aeolicus
AAM07677      141 NVVMQGDVTQIISMTSVERRKIIDEIAGVAEFDERKQKALGELEVVRQQVERVDIILEEVRTQLGKLSGERDQALKYQAL 220  Methanosarcin...
AAL81967      255 NIVLQGDITKFIKMSPLERRLLIDDISGIAEYDSKKEKALEELKQAEENLARVDLLIKEVKKQLDKLEKERNDALRYLDL 334  Pyrococcus fu...
BAC09477      138 NVVLQGDVTSMISMNAKARREIIDELAGVADFDRKIAQAREKLDTVKEREERFRIVERELIQQRDRLQRERLHAEKYQAL 217  Thermosynecho...
BAC91263      135 NVVLQGDVTGIIAMPARERREIIDELAGVAEFDRKIEAARRELGEVEVRSDRIQAVVSELLEQMERLQKERAKAEEYRKL 214  Gloeobacter v...
CAC11918      132 SFVLQGDINDFISYSGQERRKLIERISGVDQFDSEIERVKADIEAVSRNMEINQTIIDEKRQNLERLRTEKEKKERYDAL 211  Thermoplasma ...
BAB59963      132 SFVLQGDINDFVGMSGVERRKLIERIAGTEQFDVELEKARNDIEEVGKNLDILSSMIDIKGQEVEKLRIEKEKKERYDIL 211  Thermoplasma ...
WP_010879055  130 NVVMQGDVTRIIEMSPFQRRKIIDDVAGISEFDEKKEKALEELERVRESIEKLEAVIAEVNDRLQTLERDRNEAIRYKEI 209  Archaeoglobus...
WP_010902208  159 NVVMQGDVTGIINMTAGERREIIDEIAGVAEFDAKKRDAFEELDVVEERIGEAELKIDEKRDRLDRLADERETALEYQDL 238  Halobacterium...
WP_010880376  141 NVVYQGDIVKFLKMTPVERRKIIEEISGIGEYERKKEKALEELAEVELKIKEIDLILEEISNQLKRLKEEKEKLEKFKEL 220  Aquifex aeolicus
AAM07677      221 KTEKIKFEGYVLLSKLKDARTELENVDKELAGKEEHLEKVQVLLDERVKELEALEQVLEQISLEIRKKGEDEQLQVKKEI 300  Methanosarcin...
AAL81967      335 KDKLEKAKVSLLLGEIKILETQIKEGEKRRAEIEEEIQKIEKEIEKIGKEIVEKVKVLREIEERIEKESGEEAIQITKKI 414  Pyrococcus fu...
BAC09477      218 RLELQEREQWLLVRQWQAHEEQKVQLQAQIQTLQQEQTQRQEQLQQKAQEMAAAAVTLEQLNRQVKALGEEEYLRLQATL 297  Thermosynecho...
BAC91263      215 RAELGELALWEHLLSVRSLEAQIAQITSQLAAAEAVLAGFDREAEALAERCEQALDELDTANTRVKAMGENEQVALRTQM 294  Gloeobacter v...
CAC11918      212 LKRKRDVEYTEILNRKNAMERQKRTIEGQISDLTKEIAQLEERRSDLEKRSEAIRIRREDVAKRIDDLTSGEMNRVKTDL 291  Thermoplasma ...
BAB59963      212 SKRLRDIRFTELSKAKEANDRSIQAIDRQVDSIEKEIEKSKVLISDLNLRYHSIEQLLSEETKKLNDLTSGEIRTVQEKL 291  Thermoplasma ...
WP_010879055  210 LSKKEEYEGYLRAHNYLTAVKSKEKVERELERLERQKDELTSKIPEINARIAELNEKINELAAKISELGDERSAEIQSRI 289  Archaeoglobus...
WP_010902208  239 QEEKQEYEGYAKAAELEETRADLSATRADIDEQERELEGLTAELDERRDTVGRIEADLAALNAEIERKGEDEQLAIKREI 318  Halobacterium...
WP_010880376  221 QRIKRETEAKILLKEKEKLLKERERILNELSSLRESLEDITFQIQENEKELNERERLLKEVNEKIMP--------FKEKV 292  Aquifex aeolicus
AAM07677      301 EETKGEISRCVDSIELSESELEDADAKRRKAFVDIDATKGKVAELEEKIEAENVRKESISSELSERKTERMLLQSRIADV 380  Methanosarcin...
AAL81967      415 GEVTSKIELTKRNIEVAKEELEDAQRRLAKTKEELRKVLSEIEKSKGAITRWKKRRDALINEIKKKEEERNVLVVKLGEI 494  Pyrococcus fu...
BAC09477      298 ADLHAQQRQCQRQQAANQQQQEQLAEQLQQGQAQYHRQQAQHRQLAEELAQQRGDRTPLMTAVANSQATLEALRQQVQEL 377  Thermosynecho...
BAC91263      295 ASVQAQRAQAEAALADLAQQQRQAQGRQQQLELELGELALTLTGFSRRQQDQQALVAQWTARLESDRQVLETSRNDLEQL 374  Gloeobacter v...
CAC11918      292 HSVEVDIAKIRGIIDEKNRNMEKLEETIAKYESERDSTDREIEDLDRQIEEKAKRKRALEDRYADLKKRYDDLFSRAQAE 371  Thermoplasma ...
BAB59963      292 RSLEISIASLDSKISEKKLRMQDMAKQEAIDDARREKYEAEAEEIRKSLESERRERDKLQEEFIAAEDEYNKLVAEAQEK 371  Thermoplasma ...
WP_010879055  290 LELSSELESLRRAERFYLDEAKRLEEESVKIISEISKIKEEMESLDGELEEYAIKRIQVGEIVDELAAKMELLRQRLEEV 369  Archaeoglobus...
WP_010902208  319 EEIKGEVSRLEDTVAACEDRVQDADAERREAVVEIDRKRERIDALETDIREVKVQKASVTAEIQERRDELADIEAEIESV 398  Halobacterium...
WP_010880376  293 GKFTAEIENAERSIKEKERELKESENRVKNLEELINNLLSDKENLEREVGTLQLELEKLKEEYKSLKEVEREKLRELEEE 372  Aquifex aeolicus
AAM07677      381 DAKFAATRDELMAARKKLEDVKNEKNELIRNEDRLLDTLRRKSSELRDIENQIKDAEAAVTASDSDTLSVRYEIEKLTGN 460  Methanosarcin...
AAL81967      495 DKTFGAAREEFDSVVKELEETTRKMYEIEGNIRRLQEEKEKLHSRILFLRAKLPGIKEKINEFKAVVEDKRAEISEIEGK 574  Pyrococcus fu...
BAC09477      378 STAAQTWFQEHSQRRQRIDALIHELEPSRTELSRLQERSQQLRQRQGELHQAATALEGQQLELQDALTTAAAAIKQQEQQ 457  Thermosynecho...
BAC91263      375 SASSRRWVEEQSQLRRRLDQLQSEHDPLQRTLDRLGDRLVQATGEGERHREELARIEAGHAQLATEAKVAQERLAAARTR 454  Gloeobacter v...
CAC11918      372 AVDAAETRRKSKEYQEKIDGLGREIEELK--------------AAGSQMNADLAVLLQKKAALEERKEDLDLKIRTSEWK 437  Thermoplasma ...
BAB59963      372 EKENATSRVKTKDYQVKISKLNDEINSLK--------------EKLAEINMAIKGKIDRITELEERMEDIGLKVKADEWK 437  Thermoplasma ...
WP_010879055  370 DKKHRELRDRLVSRKEELEMYKERRGEILRERDKLIELLRRIDMDVEDIKNEIASIESKLKEFETEKKAKQEEVWKQEEE 449  Archaeoglobus...
WP_010902208  399 DTEFDELKAALADEKTALEDAKRERNDHQREQDRLLDEAKRRSEELADAEADLEDARAELPEVDATLDELADELEKATRN 478  Halobacterium...
WP_010880376  373 EERLKITFDEVKKLEEEKEKLTEKLNSLN-----K--EKQELEIQRANLKNKIERIKEDINKLISEREEKIKEIKEKEQE 445  Aquifex aeolicus
AAM07677      461 LESLIKDRDDIESSHFRIKEDIRKLESRLHSLQQEYAIAEARVraseqGGGYSRAVEMVIGASGQnelfGIHGTIAQLGK 540  Methanosarcin...
AAL81967      575 LSTIQAKRIKVEKEIEAKSNELEKVSKELESSERELIAAEAQR-----EVRGNRAAEELKRSGIG----GIYGTLAELIK 645  Pyrococcus fu...
BAC09477      458 LQTLAQQLATAQQQLSRTEETYQRLEREQRQKQRELDQLEARQqavqeTQ-GGFAARLILSADLP----GVLGLVAQLGQ 532  Thermosynecho...
BAC91263      455 LEQTRADLEAERAQILADRTTQRRLEKERTEKARELDRLETQRqvwreAE-GSRATQEVLGSGIQ----GVHGLISQLGR 529  Gloeobacter v...
CAC11918      438 AKETSEDMGKYSRKYYDLKAKYDQINDRISDLKSEISEKEASAkiassRVPEYVRNVKMLEESVE----GVIGLVRDLIS 513  Thermoplasma ...
BAB59963      438 LSQNAEDLSKYRDRYYKLKSEYDEIQEKISKLSSQISAAEATArasvpRQIDRASQVEEIKKNIS----GVVGQIRDLIS 513  Thermoplasma ...
WP_010879055  450 LMSAKKMLSSADKKLFDIRAKISDVEDELKKAELELAKVKATLstlrtYS---KPVEILLDARNRrelpGIFGTVAQLGE 526  Archaeoglobus...
WP_010902208  479 REQIVDVVEDLKQEKRQRQEDLAAVEDELSAAQEEYARLEAQAdqsgdSS-YGKAVTTVLNDDRD----GVHGTVGQLGG 553  Halobacterium...
WP_010880376  446 IKRLKAIKKKEEEELRNLTQELNIYEKRLSEVRKKLEEVLKEKgaierEVRSFSDVSDVFKD-IK----GVYGSVSELIR 520  Aquifex aeolicus
AAM07677      541 VD-RRYAAALEVAAGNRMQAVVVDNDGDAAEAIEFLKRRKGGRATFLPLNKMRDS--RRLGSLSYEngv-igyAIDLIEF 616  Methanosarcin...
AAL81967      646 VKdEAYALAIEVALGNRADNVVVEDELVAEKAIKYLKEHKLGRLTFLPLNKIKPK--HVDSSVGLP-------AVDVIEY 716  Pyrococcus fu...
BAC09477      533 VE-PRYQLALEIAAGARLGNIVVADDSVAAAAIALLKREQAGRATFLPLNKMAR---PKPLSPIALagc-idyALNLVTF 607  Thermosynecho...
BAC91263      530 VE-AQYQGALEVAAGNRLNNVVVEDDAVAAQAIELLKSRRAGRATFLPLNKLRS---GRYLERLHEega-igyALDLIEF 604  Gloeobacter v...
CAC11918      514 YG-EKYVKAVESAGGGRLNAVVVKDDAVAKECIQILKDRKISPMTFLPLNKMRDPpaQRDVGKISKdpgylgiLMDFVDF 592  Thermoplasma ...
BAB59963      514 YG-ERYAIAVESAASARLNAVVVDTDVTAKRCIEYLREKKISPMTFLPLNKMRAMsnLSEPDILSRdagflgfLIDFIDF 592  Thermoplasma ...
WP_010879055  527 VD-EEYVAAIEAAAGNALQFVVVETEDDAVSAINFLKAVRGGRATFIPLRRIKSFklSLDKSILKEdgv-idfAVNLVRC 604  Archaeoglobus...
WP_010902208  554 VR-EQYATACETAAGGRLANVVVDDDGVGQRCIEYLKQRNAGRATFLPITEMQQ---RSLPSAPAMpgv-vdfAYDLVDF 628  Halobacterium...
WP_010880376  521 VKnPEHITAIEVAGGGRLKFIVVEDEEVAKECIQLAKRMNLGRFSFIPLNRVRVE--ERPLRYPRTkga-vdfAVNLVEY 597  Aquifex aeolicus
AAM07677      617 DPEFEPAFWYVFQDTLVMEDLASARRLmG-KARMVTLEGELLEKSGAMVGGS----LSSKSGISFAAAEKDKLLELAEEI 691  Methanosarcin...
AAL81967      717 DQKIENAVKFALGDTVIVNSMEEARPH-IgKVRMVTIEGELYERSGAITGGH----FRARGLAVDTTKLREKVESLRRRK 791  Pyrococcus fu...
BAC09477      608 EPQYAPIFAYVFGSTLVFESLEAAREYlG-QYRMVTLEGELLEPSGAMTGGSqrrpNTLRFAQGVPPQESAEVQQVRDRL 686  Thermosynecho...
BAC91263      605 DRRYEAAFVQVFGDTVVFRSLELARRQlG-RYRMVTMAGELLEKSGAMTGGSl---DARRGGSGFALSEPPELAEMRARL 680  Gloeobacter v...
CAC11918      593 EDQYRSAVYYAIRDTILVQDIDAGRRLmG-IFRLVTLDGDIFDPGGSITGGYr-----------NYASDYASALRMQHDL 660  Thermoplasma ...
BAB59963      593 DDKYRNAVFWVFRDTGLVSDIDAGRRLmG-SIRLVSLDGDVFDPSGSITGGFr-----------RQVRQPARSP--SEDL 658  Thermoplasma ...
WP_010879055  605 DKKFQPVFRFILRDTVVVDRIETAKRLmDrGFRFVTLDGDIVEKSGLMTGGS-----AEKRGILVSRELLEKERMLSDKI 679  Archaeoglobus...
WP_010902208  629 DERYAPVFSYVLGSTLVVENMETARDLmG-EFRLVTLAGDLVEKSGAMTGGS----RSG-SRYSFSKSGKGQLERVAERI 702  Halobacterium...
WP_010880376  598 DPKFEKVVKFVFGDTLIVENFESAKAIgIgNYRMVTLEGELFEKSGVITGGA----VKPSG-ELNKRYYEEELQRLNAEE 672  Aquifex aeolicus
AAM07677      692 KSLDASRNAAISKQDSIESHVFELSRKIRDCEASISRKELELQEIAGREAKLAELLEAKQADLRAIEEARTELRAEMDRV 771  Methanosarcin...
AAL81967      792 EALEGELNSLKIELRSLENASFELRIKLSDEKKELELASKDLNRLLEEENAVKEEIEESERKIQEIEQKIENEKSELAKL 871  Pyrococcus fu...
BAC09477      687 GELERLLDRLLQERTHQQGRVNALSQALSEAHQSHRDRQRQWEQLQQQQQQLNRQQAELERQQQYLSQELTAAETELTHL 766  Thermosynecho...
BAC91263      681 GDLDRLLATLAERLERREQRAHELQSAAEAAQRELVAIENRAEQLGREHSTQQARATQLRVFLDSCQVGLEADRQEQADL 760  Gloeobacter v...
CAC11918      661 EGMKIQLSSLMDDRSRIKREMDQAFSEMSEASRRTGEIMKEQEMLKKEAERSREELKQVMDDISSTDRAIADKKRMIDEN 740  Thermoplasma ...
BAB59963      659 DSMKKELAFLQSEKAKIKKELDEALQSMSDASKKTGEIEKERQIINDDLAKNKQILKDIASELSKLKQEIAENKEEKEAL 738  Thermoplasma ...
WP_010879055  680 YELQREKEGLFAELNRAESLRKQYKDEVDRLTGMISELRNRISLLDEKIRTESGRIEELREKISQKSREKENYISSLKDY 759  Archaeoglobus...
WP_010902208  703 QGLEDDREDCRQEVREIDQRLDSARDRRQDATEQVRTIQADIEAAEADREAAVERIADLETRIEELQDEREAVDAEMQTV 782  Halobacterium...
WP_010880376  673 EKLKNEESIIQKKIREIRNLISEKTALLKVSERKIEELSSEG--LEQYEEKFKEKLENSKEYLKILEEKLLNVEDKLKEL 750  Aquifex aeolicus
AAM07677      772 IAEKAEKEAVASELEDQVAELEAKLADSPLPEINKKAEFVDEEIRRLEGRIRDTEASLNALQ-LEKEYAEQKIAEAKELI 850  Methanosarcin...
AAL81967      872 RGRIQRLERKKEKLKKALENPEARELMEKIRIIDGEISSLKEELSRIESRIESLESRLNEELlPRKASLEEEIEGLVNKI 951  Pyrococcus fu...
BAC09477      767 EARLPELEAELAAERLALNALEASPSHQQWQQVQAQLQAQEKIHASQVAALQAVDQALGDRHrQLEQLERDLKQTEQEIQ 846  Thermosynecho...
BAC91263      761 AARLGPLREQIVQVREELAKLEQSDNHHRWQQSQQHLRELETEVRRWELQLRHAEADLQKSH-LDEQLAQEKRQNLLSRR 839  Gloeobacter v...
CAC11918      741 EKVIEQKTLDLHKYQEALNDLYDRIDPEFFKNIGDLSNEINEVRSEIDAVASELNQITSRRD-----ILSSERKHLEDQM 815  Thermoplasma ...
BAB59963      739 EKDISDRQLDLHKYQEALNDIYDDLGQSIIDTIENSMRKLEDYRKKISAITADIEVKEKRVS-----FLDKESNNIVQQN 813  Thermoplasma ...
WP_010879055  760 NSKLAEMEEAIGELEAEIEEIERMLRGSEVPKIVEELDKIKEEHQRNREILISIEKKIESLE-FKREQLESSMQEKQVYL 838  Archaeoglobus...
WP_010902208  783 DAEIDAQQETIAAIEAEIESLEAELAESRIPELTAEKEDIEATVVDLEGRVDELDGELNSLT-LEKEYAEDAVEDLQADV 861  Halobacterium...
WP_010880376  751 AEEIEYYEEKLNNLKLKEGDIKRHYSREGVEEKRREYSKVRKQVSEIEKSLNEIERELNKKTy-ELEYLEKEIQEKERER 829  Aquifex aeolicus
AAM07677      851 RELDEKKASRREKVDSLKAKIAELEARLEEKQNRELQLSDELIGLQKERENVQAEYSAVKRRVNTASTTLEKAKQQVLTL 930  Methanosarcin...
AAL81967      952 NALKNNISENEKALELLNKELEKLKSIEENIKGEIRTLREKRKKLEEDISKLREKKEVLQRKLQELEIEANTLKVRDAQL 1031 Pyrococcus fu...
BAC09477      847 RLCQAQREMRCQQQALDQT-LGDLATQIERTQAALRELDSRLGHLKGDRDRHEYQLRQQQKNYQQLEWQYQK----ASET 921  Thermosynecho...
BAC91263      840 LDWEDQKVEFGQREEESRTRLAEFDRVIAELAAQVAELEERLVDIKRERDRLEAHGRALQQRQGQLNLQREQERLHQGQR 919  Gloeobacter v...
CAC11918      816 IDTKLQENSIAAEIDDLNGKKRELEEKAKKYQYALNDLEGRYGNLSAQVREADKQIREMENGINDAKASIDLKNDLMNDL 895  Thermoplasma ...
BAB59963      814 IELEIQRKAVEDEIHNIEIQKRSMEEELKKHELFLKQLESSHSDIASKIKDMENEMKEIRSKIEEINSDVEIKRSILSEL 893  Thermoplasma ...
WP_010879055  839 DEIKDRIDEIRRTIEEGKARVEEINSELEELRKEERELGKELKGLRKERDELIKQLRNAEEEKRKIEAEIDRLEERIKLQ 918  Archaeoglobus...
WP_010902208  862 ADAESRKADEQARIEALNGDIEAKQAELAEKEAAVEDLEAELADLKRDREERKADLSEAEDARDEQAAAVEDARHRLERL 941  Halobacterium...
WP_010880376  830 EYLTERIKSLKKEIENLILFKEKTLQEVKEAEVKVYDYIKQKEELEKEILNLKSKLGKLKIKEEELKEKIFEKEKNLKVL 909  Aquifex aeolicus
AAM07677      931 TATKSALFDQEKQLLEEIeRRGIEESsevPSYETVYMRIQAIEEAMRRLEPVNMRAIDEYKEVELRLSDLQGKRDTLFTE 1010 Methanosarcin...
AAL81967     1032 NAQLEEKKYQLTHYDKNLiKSIKEIP---LDLEKVKKEIEKMEEEIRSLEPVNMKAIEDFEIVERRYLELKSKREKLEAE 1108 Pyrococcus fu...
BAC09477      922 LTTLQAQLQELSTIEPPPlPQPLPEVpaeLSLRDIQQQCQALEQRLRAMEPVNMLAIQEFEETQARLKELQEKLAVLAAE 1001 Thermosynecho...
BAC91263      920 AAALAAAQERLDELGPP--AEDVPPPpedLSLEQLQATRLRKQRRLEALEPVNMLAIEEYDRTAERQGELSEKLATLQRE 997  Gloeobacter v...
CAC11918      896 KVKAGILEGNLSSIER----ELSSYSgceAVIGDLQAMRQEIERAIMDLGEINNAAPQQYEDALKDLDDYEKKHEKLMEE 971  Thermoplasma ...
BAB59963      894 KVKRSVVADRNSAIEA----EMQSIPeptMIEGDIVLEKRKCEADISALGDINNGAIQEYEESVKAYNELKDKKNRLELE 969  Thermoplasma ...
WP_010879055  919 KERLEIAESEIAEIG------EVEVPenlPPLEKVEKVLDEVLVELSTFGDVNLKAIQEYEEVKARRDELVEKKMVLEKE 992  Archaeoglobus...
WP_010902208  942 QAAAQTLSEEVAELDDAV---GEYDPaeiPDADVVAENVERLGARMEALEPVNMLAIDEYESVADTLDSLEAQRATLTEE 1018 Halobacterium...
WP_010880376  910 EEKIENLNEELKEYEDLKlGADEES------IPKLKEKLKRVTEEIQKLGSVNFRAEEDYAEELKRFNDYKEKQQKLKEE 983  Aquifex aeolicus
AAM07677     1011 REQLLERIDQYEQLKRDAFMEAYISINSNFKEIFYELS-DGMGELLLENPDDPFAGGMTLRAQPKEKTLQRIEAMSGGEK 1089 Methanosarcin...
AAL81967     1109 KESIIEFINEIEKEKKNVFMRTFEAISRNFSEIFAKLSpGGSARLILENPEDPFSGGLEIEAKPAGKDVKRIEAMSGGEK 1188 Pyrococcus fu...
BAC09477     1002 RTEILLRIENFTTLRHQSFREAFDAINANFQTIFATLS-DGDGYLQLESPEDPFAGGLNLVAHPKGKPVQRLASMSGGEK 1080 Thermosynecho...
BAC91263      998 RSELLLRIEDCDTLKRSAFMQAFDAVNTHFQSLFAELS-DGDGHLALEDPDNPFAGGLTLVAHPRGKQVRRLEAMSGGEK 1076 Gloeobacter v...
CAC11918      972 KKALEETTAMLNEKKREVFVKTFTDISEKMNYVYGIIN-GGTAKLIMIG-SDPLTSSVEVSVTPKDKATVKIQALSGGEK 1049 Thermoplasma ...
BAB59963      970 RRSLQDLTDSLNKKKKEVFVSTFEKINEKMNYVYGTIN-GGTASLVLKG-DDPLESAVEVSVTPKDKATVKIQALSGGEK 1047 Thermoplasma ...
WP_010879055  993 RADILDRIEKYERMKREIFFEVFTAINRNFAEIIRELA-NGEGELYLDS-DDPFNSGLYIKVKPNNKPVQKLESMSGGEK 1070 Archaeoglobus...
WP_010902208 1019 ADGIRERIARYDEQKKSTFMAAFEAINDHFHRIFSRLS-AGTGGLELETPDDPFDGGLTMKAQPGDKPVQRLDAMSGGEK 1097 Halobacterium...
WP_010880376  984 SKAIKKLIEETENKKRKVFLEAFNQINKSLKRIFSFLSpGGKAQMFLDNPEDPFSGGVQLTVKPRGKDVQYLEAMSGGEK 1063 Aquifex aeolicus
AAM07677     1090 SLTALAFIFAIQQYRPAPFYAFDEIDMFLDGWNVERVSRRVKTSGSKVQFIVVSLRKPMIQAASRTIGVTMQeNNITSIT 1169 Methanosarcin...
AAL81967     1189 ALTALAFVFAIQKFKPAPFYLFDEIDAHLDDANVKRVADLIKESSKESQFIVITLRDVMMANADKIIGVSMR-DGVSKVV 1267 Pyrococcus fu...
BAC09477     1081 SLTALSFIFALQRYRPSPFYAFDEVDMFLDGANVERLAKMIQQQSQQAQFIVVSLRRPMIEAAQRTIGVTQArGQHTQVI 1160 Thermosynecho...
BAC91263     1077 SLTALSFIFALQRYRPSPFYAFDEVDMFLDGANVERLAKMVRQQANSTQFLVVSLRRPMIERADRAIGVTLArAGHSQVL 1156 Gloeobacter v...
CAC11918     1050 SVAALSFITAVQILMPSSIYFLDEVDMYLDAYNAENMIKMISQNAGEAQTIVISLKSLVFSYASNAIGVTSV-NGESFVF 1128 Thermoplasma ...
BAB59963     1048 SIAAMSFITAVQMLMPSSIYFLDEVDMYLDAYNAESMIRLIREKAGEAQTILISLKVSVFEYAANAIGITSR-NGESYIF 1126 Thermoplasma ...
WP_010879055 1071 SLVALALIFAIQMYKPAPFYAFDEVDMFLDGVNVGRVAKMIKKRSKDAQFIVVSLRKPMLEQADAIVGITLGrDNVSQVT 1150 Archaeoglobus...
WP_010902208 1098 SLTALAFIFAIQRHTPAPFYALDEVDAFLDAVNADRVGELVDELAGDAQFVVVSHRSAMLDRSERAIGVTMQaDNRSIVT 1177 Halobacterium...
WP_010880376 1064 TLAALSLIFALQEYKPSPFYYFDEVDAHLDEVNAKKVGELIREKSKEAQFIVVTLREVVTSFADKIVGVSAR-GGISEVF 1142 Aquifex aeolicus
AAM07677     1170 GVKL 1173 Methanosarcina acetivorans C2A
AAL81967     1268 SLSL 1271 Pyrococcus furiosus DSM 3638
BAC09477     1161 GLDL 1164 Thermosynechococcus elongatus BP-1
BAC91263     1157 GVKL 1160 Gloeobacter violaceus PCC 7421
CAC11918     1129 NGHF 1132 Thermoplasma acidophilum
BAB59963     1127 QKDL 1130 Thermoplasma volcanium GSS1
WP_010879055 1151 GIKL 1154 Archaeoglobus fulgidus
WP_010902208 1178 GIDL 1181 Halobacterium salinarum
WP_010880376 1143 FLKN 1146 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap