1M1B


Conserved Protein Domain Family
PEP_mutase

?
TIGR02320: PEP_mutase 
Click on image for an interactive view with Cn3D
phosphoenolpyruvate mutase
This family consists of examples of phosphoenolpyruvate phosphomutase, an enzyme that creates a C-P bond as the first step in the biosynthesis of natural products including antibiotics like bialaphos and phosphonothricin in Streptomyces species, phosphonate-modified molecules such as the polysaccharide B of Bacteroides fragilis, the phosphonolipids of Tetrahymena pyroformis, the glycosylinositolphospholipids of Trypanosoma cruzi. This gene generally occurs in prokaryotic organisms adjacent to the gene for phosphonopyruvate decarboxylase (aepY). Since the PEP phosphomutase reaction favors the substrate PEP energetically, the decarboxylase is required to drive the reaction in the direction of phosphonate production. Most often an aminotansferase (aepZ) is also present which leads to the production of the most common phosphonate compound, 2-aminoethylphosphonate (AEP). A closely related enzyme, phosphonopyruvate hydrolase from Variovorax sp. Pal2, is excluded from this model.
Statistics
?
PSSM-Id: 274077
View PSSM: TIGR02320
Aligned: 16 rows
Threshold Bit Score: 391.298
Threshold Setting Gi: 114879
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1M1B_A             11 LKQMLNSKDLEFIMEAHNGLSARIVQEA----------GFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDV 80  Mytilus ed...
REF_jgi:Pcar_0628   8 FKSLLHSPDVQFLMEAHNGLSAKIVEEA----------GFKGIWGSGLAISAALGVRDNNEASWTQVLDVVEFMSDASSI 77  Pelobacter...
P56839             11 LKQMLNSKDLEFIMEAHNGLSARIVQEA----------GFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDV 80  Mytilus ed...
CAC93955           14 LKSMLRSKELSFLMEAHNGLSARIVEET----------GFKAIWASGLSISAQMGFRDNNEASWTQVCDVAEQMSDATSI 83  Trypanosom...
WP_011060442       11 LSQLLRRKRCLRVLEAHSPISALLAEQSrlergsgpslVYDAIWSSSLTDSTHKGLPDIEILSPSNRLHGIREIFDVCSL 90  fluorescen...
WP_011535035       12 LRQLFHDKPCLRVLEAHSPISAMLAQSVrlevr-gaslGYDAIWSSSLTDSTQRCLPDIEILSPSDRLERLNEILGVCDL 90  Pseudomona...
WP_004523200       20 FKEKLATGRALRFIESHSPISAMISEKVyvahg-asqsEFDGFWSSSLTDSTLRGRPDIEILDIASRLANVQHIFDVTTK 98  pseudomall...
KFI22920           22 LRALLKSEPTEFLLEAHNGLSARIAEEA----------GFKGVWASGLAISSQFGVRDNNEASWTQIVDMLEFMSDTTTI 91  Nitrosococ...
WP_011495608       14 LKDILLSPTTEYLMEAHNAISAKIIEEV----------GFSGIWASGLTISSSLGVRDRNEISWTQVIDAVEYMTDVVDC 83  Shewanella...
WP_011474282       14 LRELLHNGSLSFAMEAHNGLSAIIAEKA----------GFEVIWASGLAISASLGLRDSNEATWCQVLTIAEFMADAVEI 83  Rhodopseud...
1M1B_A             81 PILLDADTGyGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGR-AQPLADIEEFALKIKACKDSQTDPDFCIVAR 159 Mytilus ed...
REF_jgi:Pcar_0628  78 PIMLDADTGyGNFNNVRRLVRKLEQRGVGAVCIEDKLFPKNNSLLDDA-RQPLEAIDVFAGKIKAAKDTQQDEDFCVIAR 156 Pelobacter...
P56839             81 PILLDADTGyGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGR-AQPLADIEEFALKIKACKDSQTDPDFCIVAR 159 Mytilus ed...
CAC93955           84 PILLDADTGyGNFNNARLLVRKLEKNGVAGACVEDKLFPKTNSLLDERgAQPLADVKEFALKIRAMKDTQTDENFCVVAR 163 Trypanosom...
WP_011060442       91 PMIFDGDTG-GKAEHFAIHVKMLDRAGVSAVVIEDKCGLKKNSLFGNAvSQLQDSIEEFCEKIRVGCANRSHEDLLIIAR 169 fluorescen...
WP_011535035       91 PLIYDADTG-GKVEHFAIHVQWLARAGVSAIVIEDKCGLKKNSLLGLSvHQEQETVEHFCEKIRAGTQHRHGDRMMIFAR 169 Pseudomona...
WP_004523200       99 PLIIDGDTG-GKPEHFALNVQSLERSGVSAVIIEDKTGLKKNSLLGNDvIQHQESIEDFCEKIRVGKAAQITDDFQIIAR 177 pseudomall...
KFI22920           92 PILLDGDTGyGNFNNLRRLVRKLEQREIAGVCIEDKVFPKTNSFIGGE-RQPLAEVDEFCGKIKAGKDSQSDPDFSIVAR 170 Nitrosococ...
WP_011495608       84 PILLDVDTGyGDYNSFRRVVKKLCQRNISGCCIEDKIFPKQNSFIGER--QELASIAEFTGKIKAGIDHRENEDFVIIAR 161 Shewanella...
WP_011474282       84 PIILDGDSGhGNFNTVRRLVRKACDRRIAGVCLEDKLFPKMNSFIQSG--QILANVDEFAGRIMAAKDTQTSAAFTVIAR 161 Rhodopseud...
1M1B_A            160 VEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNN---QGPVVIVPTKYYKTPTDHFRDMGVSMVI 236 Mytilus ed...
REF_jgi:Pcar_0628 157 IEAFIAKWGLGEALKRAEAYHKAGADALLIHSKLSTAEEILAFMNEWQD---TCPIVVVPTKYYTTPTSVFQEAGISLVI 233 Pelobacter...
P56839            160 VEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNN---QGPVVIVPTKYYKTPTDHFRDMGVSMVI 236 Mytilus ed...
CAC93955          164 VESFIAGWPLEEALKRATAYAEAGADAVLIHSKKKDSSEIDAFMAHWDN---KTPVVIVPTSYASVPCTHFREIGISTVI 240 Trypanosom...
WP_011060442      170 CESLILDKGMDDAIERCLAYVAAGADGIMIHSRKKDGLEILEFARLFRRhcpRVPLICVPTSYAHLSFDELEGAGFNAVI 249 fluorescen...
WP_011535035      170 CESLILEKGLEDALARCSAYTEAGADGIMIHSRKRSGEEILEFARRFKHrhpATPLICVPTSYPQLTFSCLADAGFNAVI 249 Pseudomona...
WP_004523200      178 VESLILDKGMPDALARAAAYCEAGADGVMIHSRKKDADEVIEFAQRFRAcrrDAYLVCVPTSFNAISFSELARH-FSVVI 256 pseudomall...
KFI22920          171 VEALIAGWGLDEALRRAEAYHRAGADAILIHSKLSQADEILAFAREWGN---RAPLIIVPTKYYSTPTEVFRKAGISTVI 247 Nitrosococ...
WP_011495608      162 TEALISGYGIDEALRRAEAYYEAGADAILIHSKSSNADEVLEFCNLFTA---PCPIVIVPTKYYNTPTNVFEEAGVSTVI 238 Shewanella...
WP_011474282      162 TEALIAGRSLAEALDRASTYASAGADAIVIHSAKSTADEVLAFADAWAN---RCPLIIIPTKYYTTPTQLFRQARISLAI 238 Rhodopseud...
1M1B_A            237 WANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDE 283 Mytilus edulis
REF_jgi:Pcar_0628 234 WANQLLRSSVAAMQKTAAIIHEQQSLLGVEKEITPVKEVFRLQNTDE 280 Pelobacter carbinolicus DSM 2380
P56839            237 WANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDE 283 Mytilus edulis
CAC93955          241 WANHNLRACIAAMQASTRMIFEQESVVAVGKNIAPVKEVFRLQRLPE 287 Trypanosoma cruzi
WP_011060442      250 YANHMLRSAYMAMRDVAVGILEHGRTLEVEPRCLGIDEILDLVPGTR 296 fluorescent pseudomonads
WP_011535035      250 YANHMLRGAYSAMRQVATSILENDRAYEIEPACMPIDEILSLVPGTR 296 Pseudomonas entomophila
WP_004523200      257 YANHLLRAAYPAMLAVAEGILAHGRTLEIEERCLPVNEILKLIPGTA 303 pseudomallei group
KFI22920          248 WANHLIRAAAAAMAQVAREIHDTQTLVNIEDQVAPVSEIFRLQGAEE 294 Nitrosococcus oceani
WP_011495608      239 WANHSLRASVKAIRETAEIVFKEKSLVSVENKVASLAEIFRLNGEHE 285 Shewanella denitrificans
WP_011474282      239 WANHSLRASVASMQAVCSRIVREQSVKGVEPSISKLETIFDLLKYDE 285 Rhodopseudomonas palustris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap