Conserved Protein Domain Family
egtE_PLP_lyase

?
TIGR04343: egtE_PLP_lyase 
ergothioneine biosynthesis PLP-dependent enzyme EgtE
Members of this protein family are the pyridoxal phosphate-dependent enzyme EgtE, which catalyzes the final step in the biosynthesis of ergothioneine. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 275139
Aligned: 6 rows
Threshold Bit Score: 458.168
Threshold Setting Gi: 502650838
Created: 9-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ZP_09082325    6 LAARWRSARVAPLGLHLDSAACSRPSNATLDAVADHARHEAAAGGYVAAEAAAPVLHAGRAAVAHLVGMDAADVVFTTGS 85  Mycobacterium t...
WP_012396723   5 LADRWRAARPPAAGLHLDSAACSRQSLEVLQAVAAHGLHEAEVGGYVAAEAAAPVLDAGRAAVATLCGVPDARVVFTTGS 84  Mycobacterium m...
WP_005112999   3 LRDRWRHARPPVLGVHLDSAACSRQSIETLRAVAQHAEHEAQIGGYVAQEAATPVLEAGRAAVRQLTGMPEAHVQFTTGA 82  Mycobacterium a...
WP_011562254   5 LAERWRAARPKPAGIHLDSGACSRQGFAAIDAAAQHARHEAEVGGYVAVEAATPVLDAGRAAVAALTGLAATDVVFTTGS 84  Mycobacterium
WP_011782606   3 LAEQWRAARPPVAGVHVDSAACSRQSFAVIEAAAQHARHEAEVGGYVAAEAAAPALDAGRTAVRALTGMSDAVVHFTTGS 82  Mycobacterium v...
WP_012887106   2 IAESWRAARSSVPPGHLDAAGCNVPSDRTLDTVIGHLRHEREVGGY----RAVPDLHASRAALAAMVGAGADDVAFLESG 77  Streptosporangi...
ZP_09082325   86 NHALDLLLSSWPQP--RSLACLPGEFGPNLAIMAA----NGFEVRALPVDEIGRVRPDRAEHLLRTDPPALVHLTALASH 159 Mycobacterium t...
WP_012396723  85 LHALDLLLGSWPREs-RTLACLPGEYGPNLAVMAA----HGFEVRLLPTLDDGRLALDDAAYELEEDPPELVHLTPVASH 159 Mycobacterium m...
WP_005112999  83 ADALRTLLQAWPADsgRVVACLPGEFGPNLMIMNH----FGFTPVWLPVDGDGRADVDGIEVFLRHEKIDLLHLTVVGSH 158 Mycobacterium a...
WP_011562254  85 NHALDLLLRSWDGD--RSVACLVGEYGPNLAIMAA----NGFQVSPLPVDTTGRLHVDAAAEALARDRPALVHLTPLGSH 158 Mycobacterium
WP_011782606  83 NHALDILLGDWTGA--RTLACLPGEFGPNLAIMAR----HGFSIKVLPVDEFGRLDVNAVGAALSSHQPALVHFTVLGSH 156 Mycobacterium v...
WP_012887106  78 TAAMAALLGGWPLPpgSRVGVTRAEYGSTVMLLYRlarlRDWKLLELPVDDDSRLDPGGLASML-AGGLDLVVLSHVSSH 156 Streptosporangi...
ZP_09082325  160 RGIAQPAARIAELCRAYRVPLVIDAAQALGHLDCA-VGADAVYSSSRKWLAGPRGVGVLAI------------------- 219 Mycobacterium t...
WP_012396723 160 RGTVQPLAMMAELCRELGLPLVVDAAQGMGQIDCA-VGADVTYSSSRKWLAGPRGVGVLAM------------------- 219 Mycobacterium m...
WP_005112999 159 RGTVQPAAEVVALARAAGVPVVVDAAQALGHIDCT-YGADAMYAPSRKWLAGPRGVGVLAV------------------- 218 Mycobacterium a...
WP_011562254 159 RGLAQPLGPFAEVCRDLGLPLVVDAAQALGHLDCA-VAPDAIYASSRKWLAGPRGVGVLAV------------------- 218 Mycobacterium
WP_011782606 157 SGIVQPVRDMASACRGHGIPLIVDAAQGFAHLDVAgIGADALYSSSRKWTAGPRGVGVLAS------------------- 217 Mycobacterium v...
WP_012887106 157 RGVVQPAAAVGRLCRAAGVPLVLDVCQSLGHVDTGdAGATAYVGTSRKWLAGPRGAGFLVVpglagdmdaaapalgghew 236 Streptosporangi...
ZP_09082325  220 -------------RPELAERLCPRLPPPDW--PVARTLRVLDRLAHGEANIAARVGFSVAVGEHLAAGPAAVRARLAEVG 284 Mycobacterium t...
WP_012396723 220 -------------RPEVLDRLTPRLAPPDWs-PDSPSTSVAQILEFGEANIAARVGFSLAVGEHLEYGPALIRARLAELG 285 Mycobacterium m...
WP_005112999 219 -------------NPVLEHLL------PQW-------------AGHVEAHVAGWVGLSVAVGQHLAAGPGQIQGALAERG 266 Mycobacterium a...
WP_011562254 219 -------------RPEFAERLRPGFPPS----EPAAPLTVLQQLEHGESNAAARVGFSVAIGEHLAAGVQQVRTRLAEVG 281 Mycobacterium
WP_011782606 218 -------------RPGLLAD------------------DTRIRLNHAETNVGLQVGFSVAVGEYVAAGPDAVQSRLREVG 266 Mycobacterium v...
WP_012887106 237 arrdvptfdgpgdGPGWVRGQAPVLDGPGWarGEVSPLAGAARYETSEGSIAARAGFGAAVLEHQALGPAAVHARLAELG 316 Streptosporangi...
ZP_09082325  285 RQTHAVLAQVPGWRVVEPPDEPTAITTLEPTAGADPAAV---RRTLI-ERGIVTTAAEPARAPFELRTPVLRLSPHIDTT 360 Mycobacterium t...
WP_012396723 286 AAARRVLADVDGWLVVEEVDEPSAITTLAPIDGADPAAV---REWLLeQRRILTTYAGIARAPQELTAPVLRVAPHVDTT 362 Mycobacterium m...
WP_005112999 267 RAARKILGELKDWRVIESVDEPSAITTLEPVGDIDVIAV---RARLIeEHAIVTTGAEMVRAPFEMTKPVLRVSPHVDGT 343 Mycobacterium a...
WP_011562254 282 RLTRAAMADVPGWRVVEPVDEPTAITTLEPTDGADPHRV---RAWLIaERRIVTTACDARRAPRELTVPVLRLSPHVDVT 358 Mycobacterium
WP_011782606 267 AATRTALADVPGWRVVEHVTEPSAITTLQSTDGIDPLDV---RTRLIaEHQIVTTYLGLERAPREMSHPALRVSPHVDVT 343 Mycobacterium v...
WP_012887106 317 VTARRLLDGIGGWRAGEPLDEPSAIVTLRPPPGVDPEAAvedARSRAaEASLLIGTVPVGRAPADLPTPVLRISPSPGAY 396 Streptosporangi...
ZP_09082325  361 TAELEQFAAALAD 373 Mycobacterium thermoresistibile ATCC 19527
WP_012396723 363 AEDLENFAEALIE 375 Mycobacterium marinum
WP_005112999 344 DEELELLAGVLAS 356 Mycobacterium abscessus
WP_011562254 359 ADELGQaaaalae 371 Mycobacterium
WP_011782606 344 dadlaaladalat 356 Mycobacterium vanbaalenii
WP_012887106 397 QEDLHALARVLDR 409 Streptosporangium roseum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap