Conserved Protein Domain Family
PLP_IMCC1989

?
TIGR04422: PLP_IMCC1989 
putative PLP-dependent aminotransferase
Members of this family are PLP-dependent enzymes, probable aminotransferases of the DegT/DnrJ/EryC1/StrS. Members occur in some Leptospira have in their O-antigen biosynthesis regions and in a related cassette in gamma proteobacterium IMCC1989. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 275215
Aligned: 2 rows
Threshold Bit Score: 643.991
Threshold Setting Gi: 417768262
Created: 9-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ZP_12416195   4 RSFFLWPDYNPIQSLSRIIYSKKISSIEDTLETLFPSGYPVLCSSGRAAIGLALEFLDLKRNDFLGVFPFASHCVLDAVS 83  Leptospira inter...
ZP_11371318   4 RSFFLWPDYNPIHSLSRVIYSKKISSIESMLETFFPSGYPVLCSSGRAAIGLALEFLDLKRNDFLGVFPFASHCVLDVVS 83  Leptospira noguc...
ZP_12416195  84 RYTTPLTGRSSKNTKNRIVYHQWGYVQEYNLPANTIEDCVDTLCVPGAKLFPAGGIFEIWSLPKILGTSSGGVLWCRDKD 163 Leptospira inter...
ZP_11371318  84 RYTTPLTGISSKNTKNRIVYHQWGYVQEYNLPPNTIEDCVDTLCVPGAKLFPAGGMFEIWSLPKILGTSSGGVLWCRDEK 163 Leptospira noguc...
ZP_12416195 164 VANQIRAIRDSRKYSGIIQWYLKLFSYKFPSLLSYWTGVEASNGKLSFLQTGEIHYSLNNWQKFIDDKLNRVEIASRLFP 243 Leptospira inter...
ZP_11371318 164 VANQMRVIRDSRKYSGTIQWYLKLFSYKFPSLLSYWTGVEAVCGKFGFLQMGELYYALNNWQKFLDDKLNRIEIALELLP 243 Leptospira noguc...
ZP_12416195 244 SWLKQTPDRIPSIIPVELTISSEKFVNWGLSSGMRTFEKYIKKKSKLIQVFPLPLHSQIPLKRFKKIVLELENIK 318 Leptospira interrogan...
ZP_11371318 244 SWLKQTSKRVPSNIPVELVISSEKFSEWKLSSGMRTFEKCIKEKSELIQVFPLPLHFQIPLKQFRKIVSELKDMK 318 Leptospira noguchii s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap