Conserved Protein Domain Family
endura_MppP

?
TIGR04462: endura_MppP 
enduracididine biosynthesis enzyme MppP
Members of this family are MppP, one of three enzymes involved in synthesizing enduracididine, a non-proteinogenic amino acid used in non-ribosomal peptide synthases to make natural products such as enduracidin from Streptomyces fungicidicus ATCC 21013. MppP is a PLP-dependent enzyme, predicted by homology to be an aminotransferase.
Statistics
?
PSSM-Id: 275255
Aligned: 3 rows
Threshold Bit Score: 500.609
Threshold Setting Gi: 503498712
Created: 9-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_018539970  92 LSCYSSSVAMEILSRALAET-TGSVALVHPTFDNIADLLRGNGLKLVPLAEDPLHGDDLDTDLLTSVGCVFVTTPNNPTG 170 Streptomyces sp...
ABD65947       2 LSCYSSSVAMEILSRALASV-TDSVALVHPTFDNIADLLRGNRLGLVPLEEDPLHADDLPAELLESVGCVFVTTPNNPTG 80  Streptomyces fu...
WP_013733373  87 LTCYSSSVAMEILARSLVPAgGGPVALVHPTFDNIPDLLRGNGLRLLPVEEDVLHEGSVSAAVPEGVRCLFITTPNNPTG 166 Verrucosispora ...
WP_018539970 171 RVLSKERLTRLAEQCAAHGVVLALDTSFRGFDTRAHYDHYEVLQASGARWVVIEDTGKLWPTLDLKVGMLVHSENLALPV 250 Streptomyces sp...
ABD65947      81 RVVSAERLRRLAGQCARHGVILALDTSFRGFDTRAQYDHYEILDASDVRWVVIEDTGKLWPTLDLKVGMLVHSENLGLPV 160 Streptomyces fu...
WP_013733373 167 RVLAEQRLAAIAAECAARDVVLALDTSFRGFDTRSHYDHYAVLRDSGCRWVVIEDTGKLWATLDLKVGLLASSDHVGLPL 246 Verrucosispora ...
WP_018539970 251 EKIYSDILLGVSPLILAMVRRFSEDAAAGGLADLHRFIAGHRAMVREELAGLPGVHVPDPDSRASVERIGLTDLTGTQVW 330 Streptomyces sp...
ABD65947     161 EKIYSDILLGVSPLILGMVRRFSEDAAAGGLTELHEFIAAQRSVVRAGLADLSTTGVPDPDSRASVERVLIRHLTGTEVW 240 Streptomyces fu...
WP_013733373 247 AKIHSDILLGVSPFVLVLVTRFAEDAAAGGLADLHRFIADNRALVRATLADVPDLAFPDGDARVSVERVDLGERRCLDVW 326 Verrucosispora ...
WP_018539970 331 ERLRAHNVYALPCRAFHWADPSQGDHTLRLALARSTDPLTQSVRALRHVL 380 Streptomyces sp. MspMP-M5
ABD65947     241 EALREHHVYALPCRAFYWADPARGDRTLRLALARASAPLAQCVRALRHVL 290 Streptomyces fungicidicus
WP_013733373 327 TRLRQSGIYVLPCSQFHWADPARGDHSLRIALARVPGALEAAVRALRAVL 376 Verrucosispora maris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap