Conserved Protein Domain Family
MYSc_Myh10

?
cd14920: MYSc_Myh10 
class II myosin heavy chain 10, motor domain
Myosin motor domain of non-muscle myosin heavy chain 10 (also called NMMHCB). Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
Statistics
?
PSSM-Id: 276952
Aligned: 36 rows
Threshold Bit Score: 1419.39
Threshold Setting Gi: 432909796
Created: 7-Jan-2013
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                    #########                                           #
Q61879         99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  house mouse
AAA48985       99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  chicken
AAA48986       99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  chicken
AAA48987       99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  chicken
NP_990805      99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  chicken
NP_001084034   99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  African clawe...
AAI66177       99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  western clawe...
JAA50060       99 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 178  common vampir...
XP_003451049   79 ASVLHNLRERYYSGLIYTYSGLFCVVVNPYKNLPIYTESIVEMYRGKKRHEMPPHIYAISEAAYRSMLQDREDQSILCTG 158  Nile tilapia
XP_003977677  108 ASVLHNLRERYYSGLIYTYSGLFCVVVNPYKNLPVYTESIVEMYRGKKRHEMPPHIYAISEAAYRSMLQDREDQAILCTG 187  torafugu
Feature 1         #######                                                             ########### 
Q61879        179 ESGAGKTENTKKVIQYLAHVASSHKGRkdh----------------nipGELERQLLQANPILESFGNAKTVKNDNSSRF 242  house mouse
AAA48985      179 ESGAGKTENTKKVIQYLAHVASSHKGRkdh----------------nipGELERQLLQANPILESFGNAKTVKNDNSSRF 242  chicken
AAA48986      179 ESGAGKTENTKKVIQYLAHVASSHKGRkdhnippe------spkpvkhqGELERQLLQANPILESFGNAKTVKNDNSSRF 252  chicken
AAA48987      179 ESGAGKTENTKKVIQYLAHVASSHKGRkdh----------------nipGELERQLLQANPILESFGNAKTVKNDNSSRF 242  chicken
NP_990805     179 ESGAGKTENTKKVIQYLAHVASSHKGRkdhnippe------spkpvkhqGELERQLLQANPILESFGNAKTVKNDNSSRF 252  chicken
NP_001084034  179 ESGAGKTENTKKVIQYLAHVASSHKGKkdhtiptespkaikhqsgsllyGELERQLLQANPILESFGNAKTVKNDNSSRF 258  African clawe...
AAI66177      179 ESGAGKTENTKKVIQYLAHVASSHKGKkdhtipte------spkamkhqGELERQLLQANPILESFGNAKTVKNDNSSRF 252  western clawe...
JAA50060      179 ESGAGKTENTKKVIQYLAHVASSHKGRkdh----------------nipGELERQLLQANPILESFGNAKTVKNDNSSRF 242  common vampir...
XP_003451049  159 ESGAGKTENTKKVIQYLAHVASSHKGGtlgrk------------keavqGELERQLLQANPILEAFGNAKTVKNDNSSRF 226  Nile tilapia
XP_003977677  188 ESGAGKTENTKKVIQYLAHVASSHKGStlgrn------------kdaiqGELEKQLLQANPILEAFGNAKTVKNDNSSRF 255  torafugu
Feature 1                                                                                         
Q61879        243 GKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQD 322  house mouse
AAA48985      243 GKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLAGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQD 322  chicken
AAA48986      253 GKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLAGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQD 332  chicken
AAA48987      243 GKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLAGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQD 322  chicken
NP_990805     253 GKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLAGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQD 332  chicken
NP_001084034  259 GKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLAGSGEHLKSDLLLDGFNNYRFVSNGYIPIPGQQD 338  African clawe...
AAI66177      253 GKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGSGEHLKSDLLLDGFNNYRFVSNGYIPIPGQQD 332  western clawe...
JAA50060      243 GKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQD 322  common vampir...
XP_003451049  227 GKFIRINFDVAGYIVGANIETYLLEKSRATRQAKDERTFHIFYQLLCGASEETRADLLLGTADQYRFLSGGSIPVPGQSD 306  Nile tilapia
XP_003977677  256 GKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDERTFHVFYQMLCGTSEELKEELLLGSVDEYRFLTCGSIPVPGQSD 335  torafugu
Feature 1                                                                                         
Q61879        323 KDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIK 402  house mouse
AAA48985      323 KDNFQETMEAMHIMGFSHDEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIK 402  chicken
AAA48986      333 KDNFQETMEAMHIMGFSHDEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIK 412  chicken
AAA48987      323 KDNFQETMEAMHIMGFSHDEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIK 402  chicken
NP_990805     333 KDNFQETMEAMHIMGFSHDEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIK 412  chicken
NP_001084034  339 KDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIVFKKERNTDQASMPENTAAQKLCHLLGLNIMEFTRAILTPRIK 418  African clawe...
AAI66177      333 KDNFQETMEAMHIMGFSHEEILSMLKVVSAVLQFGNITFKKERNTDQASMPENTAAQKLCHLLGLNIMEFTRAILTPRIK 412  western clawe...
JAA50060      323 KDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTAAQKLCHLLGMNVMEFTRAILTPRIK 402  common vampir...
XP_003451049  307 SENFTQTMDSMAIMGFTPEELMSMLKVISAVLQFGNISFMKEKNHDQASMPDNTAAQKLCHLLGVNVLEFTRAILTPRIK 386  Nile tilapia
XP_003977677  336 SENFTQTMDSMAIMGFTPEENISMLKVISAVLQFGNISFMKEKHHDQASMPDNTAAQKLCHLLGINVLEFTRAILTPRIK 415  torafugu
Feature 1                                                                 ######                  
Q61879        403 VGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEK 482  house mouse
AAA48985      403 VGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEK 482  chicken
AAA48986      413 VGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEK 492  chicken
AAA48987      403 VGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEK 482  chicken
NP_990805     413 VGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEK 492  chicken
NP_001084034  419 VGRDYVQKAQTKEQADFAVEALRKATYERLFRWLVYRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEK 498  African clawe...
AAI66177      413 VGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEK 492  western clawe...
JAA50060      403 VGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEK 482  common vampir...
XP_003451049  387 VGREYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINRALDRRQRQGASFIGILDIAGFEIFQLNSFEQLCINYTNEK 466  Nile tilapia
XP_003977677  416 VGREYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINRALDRRQRQGASFIGILDIAGFEIFQLNSFEQLCINYTNEK 495  torafugu
Feature 1                                                                                         
Q61879        483 LQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPanppGVLALLDEECWFPKATDKTFVEKLvqeqgshsk 562  house mouse
AAA48985      483 LQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPanppGVLALLDEECWFPKATDKTFVEKLvqeqgthsk 562  chicken
AAA48986      493 LQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPanppGVLALLDEECWFPKATDKTFVEKLvqeqgthsk 572  chicken
AAA48987      483 LQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPanppGVLALLDEECWFPKATDKTFVEKLvqeqgthsk 562  chicken
NP_990805     493 LQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPanppGVLALLDEECWFPKATDKTFVEKLvqeqgthsk 572  chicken
NP_001084034  499 LQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPanspGVLALLDEECWFPKATDKTFVDKLvqeqgthsk 578  African clawe...
AAI66177      493 LQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPanppGVLALLDEECWFPKATDKSFVDKLvqeqgthsk 572  western clawe...
JAA50060      483 LQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPanppGVLALLDEECWFPKATDKTFVEKLvqeqgshsk 562  common vampir...
XP_003451049  467 LQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPanppGVLALLDEECWFPRATDRSFVEKLsgeqgshpk 546  Nile tilapia
XP_003977677  496 LQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKSahppGVLALLDEECWFPRATDRSFVEKLsaeqgshpk 575  torafugu
Feature 1                                                                                         
Q61879        563 fQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKdvdrivg--------------- 627  house mouse
AAA48985      563 fQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWKdvdrivg--------------- 627  chicken
AAA48986      573 fQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWKdvdrivg--------------- 637  chicken
AAA48987      563 fQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWKdeiqniqracfydnitgl---- 638  chicken
NP_990805     573 fQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWKdeiqniqracfydnitgl---- 648  chicken
NP_001084034  579 fQKPRQLKDKADFCIIHYAGRVDYKADEWLLKNMDPLNDNVATLLHQSSDKFVSELWKdvdrivg--------------- 643  African clawe...
AAI66177      573 fQKPRQLKDKADFCIIHYAGRVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVGELWKdvdrivg--------------- 637  western clawe...
JAA50060      563 fQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVAELWKdvdrivg--------------- 627  common vampir...
XP_003451049  547 fFKSKQPRGEADFSIIHYAGKVDYKANDWLVKNMDPLNDNVASLLHQSSDHFVSELWKevdrivgld------------- 613  Nile tilapia
XP_003977677  576 fFRSKQPRGEVDFSIIHYAGKVDYKADDWLVKNMDPLNDNVASLLHQSSDHFVSELWKediqtlprvyffdsyatlhdpp 655  torafugu
Feature 1                                                                                         
Q61879        628 -------------ldqvtgmTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHL 694  house mouse
AAA48985      628 -------------ldqvtgiTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHL 694  chicken
AAA48986      638 -------------ldqvtgiTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHL 704  chicken
AAA48987      639 ---hdppvdrivgldqvtgiTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHL 715  chicken
NP_990805     649 ---hdppvdrivgldqvtgiTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHL 725  chicken
NP_001084034  644 -------------ldqvagmAETAFGAAYKTKKGMFRTVGQLYKESLAKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHL 710  African clawe...
AAI66177      638 -------------ldqvagmAETAFGAAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHL 704  western clawe...
JAA50060      628 -------------ldqvtgmTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHL 694  common vampir...
XP_003451049  614 -----------qvssgessaPVTFGAAGLKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFLRCIIPNHEKRAGKLSPHL 682  Nile tilapia
XP_003977677  656 fppvdrivgldqvssgdssgPVTFGAGGLKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFLRCIIPNHEKRAGKLAPHL 735  torafugu
Feature 1                                                                                      
Q61879        695 VLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFR 771  house mouse
AAA48985      695 VLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFR 771  chicken
AAA48986      705 VLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFR 781  chicken
AAA48987      716 VLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFR 792  chicken
NP_990805     726 VLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFR 802  chicken
NP_001084034  711 VLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNSIPRGFMDGKQACERMIRSLELDPNLYRIGQSKIFFR 787  African clawed frog
AAI66177      705 VLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFR 781  western clawed frog
JAA50060      695 VLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFR 771  common vampire bat
XP_003451049  683 VLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYEILTPNAIPRTFMDGKQASELMISALELDKNLFRVGQSKVFFR 759  Nile tilapia
XP_003977677  736 VLDQLRCNGVLEGIRICRQGFPNRVPFQEFRQRYEILTPNAIPRTFMDGKQASELMIKALELDHNLFRVGQSKVFFR 812  torafugu

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap