4N8W,1YAL,1PPO,2CIO,2ACT,2DC6,3HD3,1M6D,2O6X,8PCH,2FO5,2P7U


Conserved Protein Domain Family
Peptidase_C1

?
pfam00112: Peptidase_C1 (this model, PSSM-Id:278538 is obsolete and has been replaced by 395062)
Click on image for an interactive view with Cn3D
Papain family cysteine protease
Statistics
?
PSSM-Id: 278538
View PSSM: pfam00112
Aligned: 160 rows
Threshold Bit Score: 185.054
Threshold Setting Gi: 74963193
Created: 11-Jun-2015
Updated: 5-Aug-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4N8W_A   1 APDSVDYRK--KG-Y-VTPVKNQGQCGSCWAFSSVGALEGQLKKKTG--KLLNLSPQNLVDCVSE-ND----GCGGGYMT 69  human
P92131  79 IPPQFDFRDeyPQ-C-VKPALDQGSCGSCWAFSAIGVFGDRRCAMGIdkEAVSYSQQHLISCSLe-NF----GCDGGDFQ 151 Giardia intestinalis
P90850 184 LPEHFDARD--KWgPlIHPVADQGDCGSSWSVSTTAISSDRLAIISEgrINSTLSSQQLLSCNQHrQK----GCEGGYLD 257 Caenorhabditis elegans
Q16920  87 LPESFDARQkwSQcPsLNVIRNQGCCGSCWAISAASAMTDRWCIKSKgkEQFSFGATDMLACC----HacgdGCKGGYLG 162 yellow fever mosquito
Q03106  57 LPKVFDARSkwSGcStIGKILDQGHCGSCWAFGAVECLQDRFCIHHn--MNITLSANDLVACCG---FmcgdGCDGGYPI 131 bread wheat
Q40413 100 LPQEFDARVawSNcStIGRILDQGHCGSCWAFGAVESLSDRFCIHYg--LNISLSANDLYACCG---FlcgdGCDGGYPL 174 Aztec tobacco
O23681 103 LPKEFDARTawSHcTsIRRILG--HCGSCWAFGAVESLSDRFCIKYn--LNVSLSANDVIACCG---LlcgfGCNGGFPM 175 thale cress
Q9ZSI0 103 LPKAFDARTawPQcTsIGNILGLGHCGSCWAFGAVESLSDRFCIQFg--MNISLSVNDLLACCG---FrcgdGCDGGYPI 177 thale cress
O61066  92 LQDRFDAGEawPKcPtITEIRDQSSCGSCWAVAAASAMSDRYCTLGg-vRDLRISAGDLMSCCDvc----gyGCNGGYPE 166 Trypanosoma cruzi
P90627  98 LPEFFDAAEhwPMcLtISEIRDQSNCGSCWAIAAVEAISDRYCTFGg-vPDRRMSTSNLLSCCFic----glGCHGGIPT 172 Leishmania major
4N8W_A  70 NAFQYVQKnRGIDSEDAY-------PYV-----GQEE-------------------SCMYN-PTGKA----AKCRGYREI 113 human
P92131 152 PTWSFLTF-TGATTAec-------vKYV-----DYGHtvas-----------pcpaVCD-D-GSPIQl---YKAHGYGQV 202 Giardia intestinalis
P90850 258 RAWWYIRK-LGVVGDHCY-------PYV-----SGQSrepghclipkrdytnrqglRCPSG-SQDSTa---FKMTPPYKV 320 Caenorhabditis elegans
Q16920 163 PAWQFWVE-QGVSSGGPYnsrqgchPYPid-vcDASGeea-------------dtpKCSKRcQSGYnvtdvWQDRRYGRV 227 yellow fever mosquito
Q03106 132 SAWQYFVQ-NGVVTDec-------dPYFdqvgcKHPGcepa-----------yptpVCEKKcKVQnq--vwEEKKHFSIN 190 bread wheat
Q40413 175 QAWKYFVR-KGVVTDec-------dPYFdnegcSHPGcepa-----------yptpKCHRKcVKQnl--lwSRSKHFGVN 233 Aztec tobacco
O23681 176 GAWLYFKY-HGVVTQec-------dPYFdntgcSHPGcept-----------yptpKCERKcVSRnq--lwGESKHYGVG 234 thale cress
Q9ZSI0 178 AAWQYFSY-SGVVTEec-------dPYFdntgcSHPGcepa-----------yptpKCSRKcVSDnk--lwSESKHYSVS 236 thale cress
O61066 167 VAWEYYAV-HGIVSEyc-------qPYPfp-scAHHVnssdlspc----sgeydtpTCNSTcTdk----kiPLIKYRGNT 229 Trypanosoma cruzi
P90627 173 VAWLWWVW-VGIATEdc-------qPYPfd-pcSHHGnsekyppc---pstiydtpKCNTTcErn----emDLVKYKGST 236 Leishmania major
4N8W_A 114 PEG---NEKALKRAVARVGPVSVAIDASLtSFQFYSKGVYYDE--SCNSdn-----lNHAVLAVGYGIQK----GNKHWI 179 human
P92131 203 SKS----VPAIMGMLVAGGPLQTMIVVYA-DLSYYESGVYKHTygTINl-------gFHALEIVGYGTTDd---GTDYWI 267 Giardia intestinalis
P90850 321 SSR----EEDIQTELMTNGPVQATFVVHEd-FFMYAGGVYQHSdlAAQKgassvaegYHSVRVLGWGVDHstgkPIKYWL 395 Caenorhabditis elegans
Q16920 228 AYSipnDEQKIMEEIYINGPVQAAFMTYQ-DLHAYKSGVYRHVwgHMAG--------GHAVKLMGWGVEN----GLKYWL 294 yellow fever mosquito
Q03106 191 AYQvnsDPHDIMAEVYNNGPVEVAFTVYE-DFAHYKSGVYKHItgGVMG--------GHAVKLIGWGTSDa---GEDYWL 258 bread wheat
Q40413 234 AYMissDPHSIMTEVYKNGPVEVSFTVYE-DFAHYKSGVYKHVtgDIMG--------GHAVKLIGWGTSEd---GEDYWL 301 Aztec tobacco
O23681 235 AYRinpDPQDIMAEVYKNGPVEVAFTVYE-DFAHYKSGVYKYItgTKIG--------GHAVKLIGWGTSDd---GEDYWL 302 thale cress
Q9ZSI0 237 TYTvksNPQDIMAEVYKNGPVEVSFTVYE-DFAHYKSGVYKHItgSNIG--------GHAVKLIGWGTSSe---GEDYWL 304 thale cress
O61066 230 SYIls-gEESFKRELLLNGPFEVSFSVYA-DFVAYTGGVYKHVtgVFLG--------GHAVRIVGWGELN----GEPYWK 295 Trypanosoma cruzi
P90627 237 SYSvk-gEKELMIELMTNGPLELTMQVYS-DFVGYKSGVYKHVlgDFLG--------GHAVKLVGWGTQD----GVPYWK 302 Leishmania major
4N8W_A 180 IKNSWGENWGNKGYILMARNKNnACGIANLASFPK 214 human
P92131 268 IKNSWGPDWGENGYFRIVRGVN-ECRIEDEIYAVY 301 Giardia intestinalis
P90850 396 CANSWGTQWGEDGYFKVLRGEN-HCEIESFVIGAW 429 Caenorhabditis elegans
Q16920 295 VANSWGDDWGDNGFFKIVRGEN-HCGIEKDVHAGL 328 yellow fever mosquito
Q03106 259 LANQWNRGWGDDGYFKIIRGKN-ECGIEEDVTAGM 292 bread wheat
Q40413 302 LANQWNRGWGDDGYFKIRRGTN-ECEIEDEVVAGL 335 Aztec tobacco
O23681 303 LANQWNRSWGDDGYFKIRRGTN-ECGIEQSVVAGL 336 thale cress
Q9ZSI0 305 MANQWNRGWGDDGYFMIRRGTN-ECGIEDEPVAGL 338 thale cress
O61066 296 IANSWNHEWGMNGYFLIARGVD-ECGIEGSGVAGI 329 Trypanosoma cruzi
P90627 303 VANSWNTDWGDKGYFLIQRGNN-ECKIESGGVAGI 336 Leishmania major
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap