Conserved Protein Domain Family
UDPGT

?
pfam00201: UDPGT 
UDP-glucoronosyl and UDP-glucosyl transferase
Statistics
?
PSSM-Id: 278624
View PSSM: pfam00201
Aligned: 13 rows
Threshold Bit Score: 481.908
Threshold Setting Gi: 136743
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P36511  24 GKVLVWPMEYSHWMNIKIILEELVQKGHEVTVLRPSAFVFLDPKETSDLKFVTFPTSFSSHDLENFFTrFVNVWTYELPR 103 Norway rat
P16166  26 AVLLSIARALAAAAAPSGATLSFLSTASSLAQLRKASSASAGHGLPGNLRFVEVPDGAPAAEETVPVP-RQMQLFMEAAE 104 Zea mays
O60656  26 GKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLG--RSLNCTVKTYSTSYTLEDLDREFKaFAHAQWKAQVR 103 human
P22309  28 GKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIR--DGAFYTLKTYPVPFQREDVKESFVsLGHNVFENDSF 105 human
P20720  28 GKVLVFPMEGSHWLSMRDVVRELHARGHQAVVLAPEVTVHMK--GEDFFTLQTYAFPYTKEEYQREILgNAKKGFEPQHF 105 Norway rat
P35503  29 GKVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIK--EENFFTLTTYAISWTQDEFDRHVLgHTQLYFETEHF 106 human
P19224  27 DKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVVPEVNLLLK--ESKYYTRKIYPVPYDQEELKNRYQsFGNNHFAERSF 104 human
P08541  24 GKVLVWPMDFSHWMNIKIILDELVQRGHEVTVLKPSAYFFLDPKKSSDLKFEIFSTSISKDELQNHFIkLLDVWTYELPR 103 Norway rat
P09875  24 GKVLVWPTEYSHWINIKIILNELAQRGHEVTVLVSSASILIEPTKESSINFEIYSVPLSKSDLEYSFAkWIDEWTRDFET 103 Norway rat
P54855  24 GKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLkILDRWIYGVSK 103 human
P06133  24 GKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFEDIIKqLVKRWAE-LPK 102 human
P36513  25 GKVLVWPMDFSLWMNLNVILDELVRRGHEVIVLRNSASIFIDPSKQANIKFETFPIAATKDDLEDLFVhYVSTWTN-ARQ 103 rabbit
P36512  25 GKVLVWPMEFSHWMNMKTILDALVQQGHEVTVLRSSASIVIGSNNESGIKFETFHTSYRKDEIENFFMdWFYKMIYNVSI 104 rabbit
P36511 104 -DTCLSYFLYLQdtidEYSDYCLTVCkeAVSNKQFMTKLQESKFDVVFSDAIGPcGELIAELLQIPFLYSLRFSPGYTIE 182 Norway rat
P16166 105 aGGVKAWLEAAR----AAAGGARVTC--VVGDAFVWPAADAAASAGAPWVPVWT-AASCALLAHIRTDALREDVGDQAAN 177 Zea mays
O60656 104 -SIYSLLMGSYN----DIFDLFFSNCrsLFKDKKLVEYLKESSFDAVFLDPFDNcGLIVAKYFSLPSVVFARGILCHYLE 178 human
P22309 106 lQRVIKTYKKIK----KDSAMLLSGCshLLHNKELMASLAESSFDVMLTDPFLPcSPIVAQYLSLPTVFFLHALPCSLEF 181 human
P20720 106 vKTFFETMASIK----KFFDLYANSCaaLLHNKTLIQQLNSSSFDVVLTDPVFPcGALLAKYLQIPAVFFLRSVPCGIDY 181 Norway rat
P35503 107 lKKFFRSMAMLN----NMSLVYHRSCveLLHNEALIRHLNATSFDVVLTDPVNLcAAVLAKYLSIPTVFFLRNIPCDLDF 182 human
P19224 105 lTAPQTEYRNNM----IVIGLYFINCqsLLQDRDTLNFFKESKFDALFTDPALPcGVILAEYLGLPSVYLFRGFPCSLEH 180 human
P08541 104 -DTCLSYSPILQnlvyEFSYFYLSICkdAVSNKQLMTKLQESKFDVLFADPVAScGDLIAELLHIPFLYSLSFSPGHKLE 182 Norway rat
P09875 104 -LSIWTYYSKMQkvfnEYSDVVENLCkaLIWNKSLMKKLQGSQFDVILADAVGPcGELLAELLKTPLVYSLRFCPGYRCE 182 Norway rat
P54855 104 -NTFWSYFSQLQelcwEYYDYSNKLCkdAVLNKKLMMKLQESKFDVILADALNPcGELLAELFNIPFLYSLRFSVGYTFE 182 human
P06133 103 -DTFWSYFSQVQeimwTFNDILRKFCkdIVSNKKLMKKLQESRFDVVLADAVFPfGELLAELLKIPFVYSLRFSPGYAIE 181 human
P36513 104 -NSQWKYFSLLQklfsEYSDSCENACkeVVFNKTLMTKLQESRFDILLSDAIGPcGELLAELLKIPFVYSLRFTPGYTME 182 rabbit
P36512 105 -ESYWETFSLTKmvilKYSDICEDICkeVILNKKLMTKLQESRFDVVLADPVSPgGELLAELLKIPLVYSLRGFVGYMLQ 183 rabbit
P36511 183 QYIGGVLFPPSYVPMIFSGLAGQMTFIErvHNMICMLYFDFWFQTFREKkwdPFYSKTLGRPTTLAEIMGKAEMWLIRSY 262 Norway rat
P16166 178 RVDGLLISHPGLASYRVRDLPDGVVSGD--FNYVINLLVHRMGQCLPRS---AAAVALNTFPGLDPPDVTAALAEILPNC 252 Zea mays
O60656 179 EGA-QCPAPLSYVPRILLGFSDAMTFKErvRNHIMHLEEHLLCHRFFKNa-lEIASEILQTPVTEYDLYSHTSIWLLRTD 256 human
P22309 182 EAT-QCPNPFSYVPRPLSSHSDHMTFLQrvKNMLIAFSQNFLCDVVYSPy-aTLASEFLQREVTVQDLLSSASVWLFRSD 259 human
P20720 182 EAT-QCPKPSSYIPNLLTMLSDHMTFLQrvKNMLYPLTLKYICHLSITPy-eSLASELLQREMSLVEVLSHASVWLFRGD 259 Norway rat
P35503 183 KGT-QCPNPSSYIPRLLTTNSDHMTFMQrvKNMLYPLALSYICHAFSAPy-aSLASELFQREVSVVDILSHASVWLFRGD 260 human
P19224 181 TFS-RSPDPVSYIPRCYTKFSDHMTFSQrvANFLVNLLEPYLFYCLFSKy-eELASAVLKRDVDIITLYQKVSVWLLRYD 258 human
P08541 183 KSIGKFILPPSYVPVILSGLAGKMTFIDrvKNMICMLYFDFWFERLRHKewdTFYSEILGRPTTVDETMSKVEIWLIRSY 262 Norway rat
P09875 183 KFSGGLPLPPSYVPVVLSELSDRMTFVErvKNMLQMLYFDFWFQPFKEKswsQFYSDVLGRPTTLTEMMGKADIWLIRTF 262 Norway rat
P54855 183 KNGGGFLFPPSYVPVVMSELSDQMIFMEriKNMIHMLYFDFWFQIYDLKkwdQFYSEVLGRPTTLFETMGKAEMWLIRTY 262 human
P06133 182 KHSGGLLFPPSYVPVVMSELSDQMTFIErvKNMIYVLYFEFWFQIFDMKkwdQFYSEVLGRPTTLSETMAKADIWLIRNY 261 human
P36513 183 KYSGGLSVPPSYVPIILSDLSGKMTFMErvNNMLCMLYFDFWFQMFNKKrwdQFYSEVLGRPVTFSELVGKADMWLIRSY 262 rabbit
P36512 184 KHGGGLLLPPSYVPVMMSGLGSQMTFMErvQNLLCVLYFDFWFPKFNEKrwdQFYSEVLGRPVTFLELMGKADMWLIRSY 263 rabbit
P36511 263 WDLEfPHPISPnVDYIGGLhCKPAKPLPKDIEDFVQSsgEHGVVVFSLGSMVRNMTEEkANIIAWALAQIPQKVLWRFDG 342 Norway rat
P16166 253 VPFG-PYHLLL-AEDDADT-AAPADPHGCLAWLGRQP--ARGVAYVSFGTVACPRPDE-LRELAAGLEDSGAPFLWSLRE 326 Zea mays
O60656 257 FVLDyPKPVMPnMIFIGGInCHQGKPLPMEFEAYINAsgEHGIVVFSLGSMVSEIPEKkAMAIADALGKIPQTVLWRYTG 336 human
P22309 260 FVKDyPRPIMPnMVFVGGInCLHQNPLSQEFEAYINAsgEHGIVVFSLGSMVSEIPEKkAMAIADALGKIPQTVLWRYTG 339 human
P20720 260 FVFDyPRPIMPnMVFIGGInCVIKKPLSQEFEAYVNAsgEHGIVVFSLGSMVSEIPEKkAMEIAEALGRIPQTLLWRYTG 339 Norway rat
P35503 261 FVMDyPRPIMPnMVFIGGInCANRKPLSQEFEAYINAsgEHGIVVFSLGSMVSEIPEKkAMAIADALGKIPQTVLWRYTG 340 human
P19224 259 FVLEyPRPVMPnMVFIGGInCKKRKDLSQEFEAYINAsgEHGIVVFSLGSMVSEIPEKkAMAIADALGKIPQTVLWRYTG 338 human
P08541 263 WDLKfPHPTLPnVDYIGGLhCKPAKPLPKDMEEFVQSsgEHGVVVFSLGSMVSNMTEEkANAIAWALAQIPQKVLWKFDG 342 Norway rat
P09875 263 WDLEfPHPFLPnFDFVGGLhCKPAKPLPREMEEFVQSsgEHGVVVFSLGSMVKNLTEEkANVVASALAQIPQKVVWRFDG 342 Norway rat
P54855 263 WDFEfPRPFLPnVDFVGGLhCKPAKPLPKEMEEFVQSsgENGIVVFSLGSMISNMSEEsANMIASALAQIPQKVLWRFDG 342 human
P06133 262 WDFQfPHPLLPnVEFVGGLhCKPAKPLPKEMEEFVQSsgENGVVVFSLGSMVSNTSEErANVIASALAKIPQKVLWRFDG 341 human
P36513 263 WDLEfPRPTLPnIQFVGGLhCKPAKPLPKEMEEFVQSsgEEGVVVFSLGSMVSNMTEErANLIASAFAQLPQKVIWRFDG 342 rabbit
P36512 264 WDLEfPRPLLPnFDFIGGLhCKPAKPLPQEMEDFVQSsgEEGVVVFSLGSMISNLTEErANVIASALAQLPQKVLWRFEG 343 rabbit
P36511 343 -----KKPPTLGPNT-----RLYKWLPQNDLLGHPKTKAFVTHGGANGIYEAIHHGIPMIGIPLFAEQHDNIAHMVAKGA 412 Norway rat
P16166 327 dswphLPPGFLDRAAgtgsgLVVPWAPQVAVLRHPSVGAFVTHAGWASVLEGLSSGVPMACRPFFGDQRMNARSVAHVWG 406 Zea mays
O60656 337 -----TRPSNLANNT-----ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGA 406 human
P22309 340 -----TRPSNLANNT-----ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGA 409 human
P20720 340 -----TRPSNLAKNT-----ILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGA 409 Norway rat
P35503 341 -----TRPSNLANNT-----ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGA 410 human
P19224 339 -----TRPSNLANNT-----ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGA 408 human
P08541 343 -----KTPATLGPNT-----RVYKWLPQNDLLGHPKTKAFVTHGGANGLYEAIYHGIPMIGIPLFGDQPDNIAHMVAKGA 412 Norway rat
P09875 343 -----KKPDTLGSNT-----RLYKWIPQNDLLGHPKTKAFVAHGGTNGIYEAIYHGIPIVGIPLFADQPDNINHMVAKGA 412 Norway rat
P54855 343 -----KKPNTLGSNT-----RLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGA 412 human
P06133 342 -----NKPDTLGLNT-----RLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGA 411 human
P36513 343 -----QKPETLGPNT-----RIYDWIPQNDLLGHPKTKAFVTHGGANGIYEAIHHGIPMVGLPLFGEQPDNIAHMTAKGA 412 rabbit
P36512 344 -----KKPDMLGSNT-----RLYKWIPQNDLLGHPKTKAFITHGGANGVFEAIYHGIPMVGLPLFGDQLDNIVYMKAKGA 413 rabbit
P36511 413 AVEVNFRTMSKSDLLNALEEVIDNPfykknamwlstihhdqptkpldravfwiefvmrhKGAKhLRSLGHnlpwyqyhsl 492 Norway rat
P16166 407 FGAAFEGAMTSAGVATAVEELLRGE----------------------------------EGAR-MRARAK---------- 441 Zea mays
O60656 407 GVTLNVLEMTSEDLENALKAVINDKsykenimrlsslhkdrpvepldlavfwvefvmrhKGAPhLRPAAHdltwyqyhsl 486 human
P22309 410 GVTLNVLEMTSEDLENALKAVINDKsykenimrlsslhkdrpvepldlavfwvefvmrhKGAPhLRPAAHdltwyqyhsl 489 human
P20720 410 GVTLNVLEMTADDLENALKTVINNKsykenimrlsslhkdrpiepldlavfwveyvmrhKGAPhLRPAAHdltwyqyhsl 489 Norway rat
P35503 411 GVTLNVLEMTSEDLENALKAVINDKsykenimrlsslhkdrpvepldlavfwvefvmrhKGAPhLRPAAHdltwyqyhsl 490 human
P19224 409 GVTLNVLEMTSEDLENALKAVINDKsykenimrlsslhkdrpvepldlavfwvefvmrhKGAPhLRPAAHdltwyqyhsl 488 human
P08541 413 AVSLNIRTMSKLDFLSALEEVIDNPfykknvmllstihhdqpmkpldravfwiefimrhKGAKhLRPLGHnlpwyqyhsl 492 Norway rat
P09875 413 AVRVDFSILSTTGLLTALKIVMNDPsykenamrlsrihhdqpvkpldravfwieyvmrhKGAKhLRSTLHdlswfqyhsl 492 Norway rat
P54855 413 ALSVDIRTMSSRDLLNALKSVINDPvykenvmklsrihhdqpmkpldravfwiefvmrhKGAKhLRVAAHnltwiqyhsl 492 human
P06133 412 AVSLDFHTMSSTDLLNALKTVINDPlykenamklsrihhdqpvkpldravfwiefvmrhKGAKhLRVAAHdltwfqyhsl 491 human
P36513 413 AIRLNWKTMSSEDLLNALKTVINDPsykenvmtlssihhdqpmkpldravfwieyvmrhKGAKhLRVAAHdltwfqyhsl 492 rabbit
P36512 414 AVKLNLKTMSSADLLNALKTVINDPsykenamtlsrihhdqpmkpldravfwieyvmrhKGAKhLRVAAHdltwyqyhsl 493 rabbit
P36511 493 dvigfLLSCVAVTVVLALKCFLFVYRFFVKKEKKT 527 Norway rat
P16166 442 -----ELQALVAEAFGPGGECRKNFDRFVEIVCRA 471 Zea mays
O60656 487 dvigfLLAVVLTVAFITFKCCAYGYRKCLGKKGRV 521 human
P22309 490 dvigfLLAVVLTVAFITFKCCAYGYRKCLGKKGRV 524 human
P20720 490 dvigfLLAIVLTVVFIVYKSCAYGCRKCFGGKGRV 524 Norway rat
P35503 491 dvigfLLAVVLTVAFITFKCCAYGYRKCLGKKGRV 525 human
P19224 489 dvigfLLAVVLTVAFITFKCCAYGYRKCLGKKGRV 523 human
P08541 493 dvigfLLTCFAVIAALTVKCLLFMYRFFVKKEKKM 527 Norway rat
P09875 493 dvigfLLLCVVGVVFIITKFCLFCCRKTANMGKKK 527 Norway rat
P54855 493 dviafLLACVATVIFIITKFCLFCFRKLAKKGKKK 527 human
P06133 492 dvtgfLLACVATVIFIITK-CLFCVWKFVRTGKKG 525 human
P36513 493 dvvgfLVSCAAFLIFLVIKSYLFVYQKLVKIGKKQ 527 rabbit
P36512 494 dvigfLLACVAITTYLIVKCCLLVYRYVLGAGKKK 528 rabbit
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap