Conserved Protein Domain Family
SDF

?
pfam00375: SDF (this model, PSSM-Id:278787 is obsolete and has been replaced by 395299)
Sodium:dicarboxylate symporter family
Statistics
?
PSSM-Id: 278787
View PSSM: pfam00375
Aligned: 97 rows
Threshold Bit Score: 192.724
Threshold Setting Gi: 123749948
Created: 20-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5V627        17 L---IWRIFVAFVLGAGAGIVFGEQMAVVRPVGDLFLRLLNMLVIPI-IVFTLLTGIRQLs-PAKLGKIGGATVGLYALT 91  Haloarcula mari...
Q8RHH6         8 L---VPRLIIAIIVGILIGQFLPLWIVRIFKTFSTFFGLFLSFFIPLmIVGYVVSGIAKL--TEGAGKLLGFTAIVSYVS 82  Fusobacterium n...
Q2LQN6        19 F---TLLLILSILVGSGLGILLKKDAALLKPLGDIFLNLLFTALVPL-VFFSIASAVAGMsnGRRLGKILSAMLAVFILT 94  Syntrophus acid...
Q838Q0         6 M---ITQIAIAVVVGILVGLLIPASGNYLKIVGDVFLRLMQMAIPIL-ILGQIVQAVGSIn-PKELTSLGGRTIAVFGIS 80  Enterococcus fa...
Q24PA1        16 L---TTQIVIGTIGGIVFGALIGPWAANLKFLGDVWIRMLQMSMVPL-VMTAVAMAVGGTe-ARSVGKMGALAVKWILTF 90  Desulfitobacter...
WP_012023591  15 IlwlLGGIIIGSIFGLVFG----EDVLIIKPLGDIFLNLLFTAIIPL-IFFTIGSSVANLerTEKLGKLFVIMVLVFLAT 89  Flavobacterium ...
WP_033052523   9 syrspliLLGGIIAGAILGVVLGEKATVFEPLGNIFINLMFTIVVPM-VFVSIATAVGSMlnMKRLGKILGSLMLTFVVT 87  Clostridium bot...
WP_012645520   9 F---SLLLILSISAGLLLGsfHPGAARAIRPLGDLFLNLLFMIIVPL-VFFTVSSSIAVSadSRRLTRTSSAMVIVFLAT 84  Geobacter daltonii
WP_011968643  13 L---VLSILLGGAIGIIMG----DKAKIFAPLGNLFLNLIFTMLVPI-VFFSIASAIANMdkSKRLGRIFIITLITFGIT 84  Clostridium bei...
WP_011989007  14 L---LGSIIIGAILGIFLG----HKASVLKPFGDLFLNLMFMIIIPL-VFFSVTSAIANMkgMKRFGKIIGSTFIVFLFT 85  Clostridium klu...
Q5V627        92 TTLAGIIGLAVANVLQPG--RGLE----------FGGGEAQSKAPPSLLD-VVLGIVpNNPVAALAEGNLLATVFFVIVF 158 Haloarcula mari...
Q8RHH6        83 TIVAGTFSYMVAANLYPK--LISG----------ISSRINFEGKD--VAP-YFTIPLrPPI-------DVTAAIVFAFMM 140 Fusobacterium n...
Q2LQN6        95 GTAASVLMVIGVSIYPPA--TGVH----------IELQSAGDIQQLKTSEqIVKAFTaNDFNEILSKKNMLALILFSILV 162 Syntrophus acid...
Q838Q0        81 SLAAALWGVLMAVIFNPGygVKMT----------GFQDASIKAQEISITD-TILNFVpKNIFDSLTQGSIIQIIVFALFF 149 Enterococcus fa...
Q24PA1        91 TLISTALGYVLGLIFQPGvgVTII----------DPAQITEIPQASSFQD-TILSFFsTNIIGSMASGAMVACMVFSILF 159 Desulfitobacter...
WP_012023591  90 ILISAIVMICAVFLFPIH--EHIA----------IAKVVFEETASGSAGDqIAKLLTaNDFFELLSRKSMLALIIFSFLV 157 Flavobacterium ...
WP_033052523  88 GCFAAVLVLVVVNIWSPA--ANTA----------IAMESAKVQESASISSmIVGSLTvDDFSGLMSRKNMLPIIVFAIIS 155 Clostridium bot...
WP_012645520  85 SLVAAVGALLFMLIVQPS--PGAG----------VVLKGQPVQEVPSLLAqLVKAFTaSDFPELISRRSMLPLIVFSIGV 152 Geobacter daltonii
WP_011968643  85 AIISGIIGVISFKMFNPA--VGLDpsmf--nnlmTTNSIDTPKSVGVLEK-IVSSISvGDFSELLSRNNLLALILFSILI 159 Clostridium bei...
WP_011989007  86 ALAASIIGIIGVFIVEPA--KGIDymalkqivsgSNDSLQQVKHVGVFQQ-IVNTITvSEFTSLFSKSNMLQLIVFSVLF 162 Clostridium klu...
Q5V627       159 GIALTYVRA--RQdalaesvDSVFEAFEVGAEAMFVIVRGVLE-FGVLGVFALMASGIGT-EGIGLFSSLGELVLAVTIA 234 Haloarcula mari...
Q8RHH6       141 GITISVMRSqnKG-------ETTFKLFGEYEEIITKVLAGFVIpLLPFHILGIFSEMAYSgIVFKVLGVFLAIYLCIFAM 213 Fusobacterium n...
Q2LQN6       163 GLATSSLKE--RG-------RAFADFLTSASDVMMKVISFIMY-YAPVGLCAYFAYLTGV-FGPDLLGSYFRAMSLYYPL 231 Syntrophus acid...
Q838Q0       150 GLALNKYLQ--SHp-----eTQLFQIIVDFNEVIITVIRYVMY-LAPLGIFALIASTISH-LGLQIILPLVKYLLVYGLG 220 Enterococcus fa...
Q24PA1       160 GLGMSAYTT--NSg-----dTSVINGVKALNACILNIIKIVMK-LAPIGVFCLLANAAGT-IGFGIIIPMVKFYGAMLVG 230 Desulfitobacter...
WP_012023591 158 GFATLQSGE--KG-------NAFKSFLDSGNEVMKQLLNIIMK-FAPIGLGAYFAYQVGV-FGPQLLGVYAKPMAVYYAA 226 Flavobacterium ...
WP_033052523 156 GLAVSACGG--EE-------SAVGKLLENLNRVIMRIVEMIMK-LAPIGLGAYFANLIGK-FGPQLIGDYGRTMLIYYPM 224 Clostridium bot...
WP_012645520 153 GLATRSSKE--AG-------ASFGRFLAGGAQVFIRMVDYVMY-AAPIGLLAWFAATVVD-TGEALAAAYFNVFIVYYTF 221 Geobacter daltonii
WP_011968643 160 GFGTMISKE--QG-------KAFASFLSSGATVTMKVVNIIMY-YAPIGLGAYFANVIGQ-LGGQILSGYAKIFILYLVV 228 Clostridium bei...
WP_011989007 163 GISTAALGE--KA-------ETVTKFFTAASRVMMEMVRIIMY-YAPIGLGCYFASVIGE-LGPQILQGYLKVFILYIII 231 Clostridium klu...
Q5V627       235 IGIHIGFTYLVLLMSVIADvSPIAF-LSGAKDAMVTAFATRSSSGTLPVTMRNADEDLQIAERVYSFTLPVGATANMDGA 313 Haloarcula mari...
Q8RHH6       214 HYVYMLVMFSIAGGVSKR--NPFTL-IKNQIPAYFTAVGTQSSAATIPVNIQCGLKN-GTSPEIVDFVVPLCATIHLSGS 289 Fusobacterium n...
Q2LQN6       232 TIFYFFTGFTIYAYLAGKG-RGVRTfWKNIIPPALTALATGSSVATIPSNLEAANR-SGVPKDISELIIPIGATIHMDGS 309 Syntrophus acid...
Q838Q0       221 TILF-LGIWILVITLYCKV-SPLRL-ITNMKNMSVMALATTSSAITLPVALEETEAKLGLSKRITNLVLPLGMSLNSNGS 297 Enterococcus fa...
Q24PA1       231 VIIQFLIYFPLAAM-LCKI-SPLKM-PKKFAKMSVVALTTTSSAISLPTEMEDAVTKFGISRRVVDFVAPIGMSMNSTGA 307 Desulfitobacter...
WP_012023591 227 CIFYFFVFFSLYAFAAGGK-RAFKVfWSNNIMPSLTAVGTCSSIATIPANLTAAEK-MGIPAHVRNLVIPLGAPLHKDGS 304 Flavobacterium ...
WP_033052523 225 CLVYGMVFYPAYTYFAGGRlGVKKM-LQNILDPAVTSFATQSSVATLPVNMKACKN-IGVPEDIYNIVLPMGATMHMDGS 302 Clostridium bot...
WP_012645520 222 SAFYFVAGFSLYAFLAGGVvAVRRF-WAHMLEPSLTALGTCSSMATMPVNLEAAPK-MGVPQGISDVVIPVGAALHKDGS 299 Geobacter daltonii
WP_011968643 229 SIIYFFVFFSIYAYIASRK-EGVKLfWKNAAEPSITALATCSSAACIPVNIKAAKN-MGVSDTLANIIMPLGVNIHKDGS 306 Clostridium bei...
WP_011989007 232 SIIYYFGFFTLYAFLAGGK-NAIKIfWKNAAVPTITALATCSSAASIPVNLEFTKK-MGVPKDVTETVIPLGANIHKDGS 309 Clostridium klu...
Q5V627       314 AIRQAVTVMFAANVVGQPLV-LTEQIFVLIVAVLISIGTAGVPGAGIVM-LTVILTQVGlPLe--vVGFVAGVDPILGRI 389 Haloarcula mari...
Q8RHH6       290 MITLTSCIMGVLLLNGMPHS-LGMMFPFLCMLGIAMVAAPGAPGGAVMSaLPFLF-LIGiDAqgslGSLLIALYITQDSF 367 Fusobacterium n...
Q2LQN6       310 CLAAVLKIAFLFGIFQMDFSgPGTLLTAVGIALLSGTVMSGIPGGGFIG-ELLIISLYGfPLe--aFPIISMIGVLVDPP 386 Syntrophus acid...
Q838Q0       298 AMHMAFTVMTIAQMYQLEFD-ITKMIYLAITATFVSLANAVVPGAGLVS-LAVIVPQMGlPIe--sIAIFAGVEWFVGML 373 Enterococcus fa...
Q24PA1       308 AQCYILVILFLSQASGVVLS-PMQIGLAVLLSVLMSTGNVGIPGATVVT-YTFLAASMGlPLd--gIALLLGIDWFVGQL 383 Desulfitobacter...
WP_012023591 305 SMSSILKITFLFAMFGKDFSdPMTILLALGITVIVSIVEGGIPNGGYIG-EILAITVYGfPMeq-aLPVAMILGTLVDPI 382 Flavobacterium ...
WP_033052523 303 VISSITKIAFLFGVFKMPFTgMGTYAMAVLVSILSAFVLSGAPGGGLVG-EMLIVSFFGfPGe--aFPLIATIGFLVDPA 379 Clostridium bot...
WP_012645520 300 VIGGVLKILFAMSLFHQELT-FSRLIVVVGVAILVGVVMGAIPSGGMIG-EMLILSVFGfPPe--tLPLLAAISVIIDPL 375 Geobacter daltonii
WP_011968643 307 VIGGIYKIMFLFAIFGRDINtISSLFPILGAGLLIGAVVGAVPGGGAIG-EMLILSIFGfPQe--aLAIMLVIATIIDAP 383 Clostridium bei...
WP_011989007 310 VIGGVMKIAFLFGLLNKNMAsISSVLSIIFISFLVGAVMAAIPSGGMIG-EMLILSIYGfSQg--lLPIIMVISVIIDAP 386 Clostridium klu...
Q5V627       390 ATMNNVTGDLAVSTVVGKW 408 Haloarcula marismortui
Q8RHH6       368 GTAINVSGDNAIAIYVDEF 386 Fusobacterium nucleatum subsp. nucleatum
Q2LQN6       387 ATMVNATGDNVCSMIAARI 405 Syntrophus aciditrophicus SB
Q838Q0       374 RTILNVNSDVYSAILVAKS 392 Enterococcus faecalis
Q24PA1       384 RTVLNVDVDVLIALLVANK 402 Desulfitobacterium hafniense Y51
WP_012023591 383 ATLLNANGDVICSMMVSRF 401 Flavobacterium johnsoniae
WP_033052523 380 ATCLNSSGDTIASMIIARf 398 Clostridium botulinum
WP_012645520 376 ATLLNATGDNVAAMLVTRL 394 Geobacter daltonii
WP_011968643 384 ATLLNSSGNTVCTMIISKF 402 Clostridium beijerinckii
WP_011989007 387 ATVLNSTGNTVCSMMISRL 405 Clostridium kluyveri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap