Conserved Protein Domain Family
Tubulin-binding

?
pfam00418: Tubulin-binding (this model, PSSM-Id:278828 is obsolete and has been replaced by 459807)
Tau and MAP protein, tubulin-binding repeat
This family includes the vertebrate proteins MAP2, MAP4 and Tau, as well as other animal homologs. MAP4 is present in many tissues but is usually absent from neurons; MAP2 and Tau are mainly neuronal. Members of this family have the ability to bind to and stabilize microtubules. As a result, they are involved in neuronal migration, supporting dendrite elongation, and regulating microtubules during mitotic metaphase. Note that Tau is involved in neurofibrillary tangle formation in Alzheimer's disease and some other dementias. This family features a C-terminal microtubule binding repeat that contains a conserved KXGS motif.
Statistics
?
PSSM-Id: 278828
Aligned: 106 rows
Threshold Bit Score: 41.217
Created: 12-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0P4W8       269 IQITHKPID-LTHITSKCGSFGNIHHRPGGG 298 western clawed frog
CBY43472     258 VKITTQKLD-LTKVKSKCGSLENSKHTPKGG 287 Oikopleura dioica
XP_006675139  78 aiIFSEKKS-FSHVKSKVGSLENTTYSPSGG 107 Batrachochytrium dendrobatidis JAM81
ERG81061     582 iKIFSEKLN-VSSVKSKVGSLENANHVPGGG 611 pig roundworm
GAA48685     192 VVIVDEKLD-LTGVHSKISSLKNVKHVPGGG 221 Clonorchis sinensis
XP_001949022 639 VQVGSAPSPnLKVVRSKVGSLQNTSHKPGGG 669 pea aphid
XP_011167812 690 VQVGAAPSPnLKTVRSKIGSLDNASYRPGGG 720 red fire ant
EHJ71650     564 VQVGSAPSPnIKAVKSKIGSLENTTYKPGGG 594 monarch butterfly
CCD80270     253 VQIFNEKVT-VNTVTGKCNSLANVKHKPGGG 282 Schistosoma mansoni
GAA48685     161 VSIVNEKVQ-LGPIASKCNSFANVKHKPGGG 190 Clonorchis sinensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap