4M1M,4F4C,4F4C,4M1M


Conserved Protein Domain Family
ABC_membrane

?
pfam00664: ABC_membrane (this model, PSSM-Id:279056 is obsolete and has been replaced by 307007)
Click on image for an interactive view with Cn3D
ABC transporter transmembrane region
This family represents a unit of six transmembrane helices. Many members of the ABC transporter family (pfam00005) have two such regions.
Statistics
?
PSSM-Id: 279056
View PSSM: pfam00664
Aligned: 70 rows
Threshold Bit Score: 129.302
Threshold Setting Gi: 1170904
Created: 6-Jul-2015
Updated: 5-Aug-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4M1M_A    711 IFCAIINGGLQPAFSVIFSKVVGVFTNG----GPPETq------------rQNSNLFSLLFLILGIISFITFFLQGFTF- 773  house mouse
P47261     13 FLCIVLGILYGIANPILLAQGLGFIFPItssnGRAVDsiysliyptnlnvfIRLTIVSVTVFVAYALIFVFNVAQNYVG- 91   Mycoplasma genita...
P26363     86 GILLYLGEVTKAVQPLLLGRIIASYDRD----NEHER----------------SIAYYLAIGLCLLFVVRMLLLHPAIFg 145  African clawed frog
P26362     86 GILLYFVEFTKAVQPLCLGRIIASYNAK----NTYER----------------EIAYYLALGLCLLFVVRTLFLHPAVFg 145  spiny dogfish
Q09427    322 GIVDHLGKENHVFQPK--TQFLGVYFV-----SSQEF---------------LGNAYVLAVLLFLALLLQRTFLQASYYv 379  black-bellied ham...
P33527    329 FFFKAIHDLMMFSGPQILKLLIKFVNDT----KAPDW----------------QGYFYTVLLFVTACLQTLVLHQYFHI- 387  human
Q10185    272 IVLKLVQDVVAFIQPNLIRKIVIFVSSY----SSEHPq-------------PPQVGFSLAIAMFLTNVVQTALLQQYFQl 334  Schizosaccharomyc...
P39109    291 AFFKAIHDVLAFTQPQLLRILIKFVTDYnserQDDHSslqgfen-nhpqklPIVRGFLIAFAMFLVGFTQTSVLHQYFLn 369  Saccharomyces cer...
P21441    235 ILPKLLSDVTALMLPVLLEYFVKYLNADn---ATWGW----------------GLGLALTIFLTNVIQSCSAHKYDHIS- 294  Leishmania tarent...
AFQ59574   19 FFSAIAGGLMELSFPLIVNYFIDTLLPG----RDWG----------------LIIATSIGLFAVYALSSALQYIVTYWG- 77   Bacillus subtilis...
4M1M_A    774 -GK-AGEILTKRLRYMVFKSMLRQDVSWFDDpkNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLGTGIIISLIYGW 851  house mouse
P47261     92 -IK-LYQQTCATLRWKAYLKMQSMSTSFFDT--QNNGDLMSRLTNDMYNIDNLFTQAGGQAIQSLFNILTTSVLIFLLSP 167  Mycoplasma genita...
P26363    146 lHH-IGMQMRIAMFSLIYKKTLKLSSKVLDK--ISTGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVLL-LMGLLWDLLQ 221  African clawed frog
P26362    146 lQH-LGMQMRIALFSLIYKKILKMSSRVLDK--IDTGQLVSLLSNNLNKFDEGVAVAHFVWIAPVQVVL-LMGLIWNELT 221  spiny dogfish
Q09427    380 aIE-TGINLRGAIQTKIYNKIMHMSTSNLSMgeMTAGQICNLVAIDTNQLMWFFFLCPNLWTMPVQIIVGVILLYYILGV 458  black-bellied ham...
P33527    388 -CFvSGMRIKTAVIGAVYRKALVITNSARKS--STVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGP 464  human
Q10185    335 gMV-LGMRWRSELITAIYRKSLRLSSAARQS--RSVGDIVNYMSVDTQKVCDLTMFLFVIVSGPFQIVLALTNLYHLVGY 411  Schizosaccharomyc...
P39109    370 vFN-TGMYIKSALTALIYQKSLVLSNEASGL--SSTGDIVNLMSVDVQKLQDLTQWLNLIWSGPFQIIICLYSLYKLLGN 446  Saccharomyces cer...
P21441    295 -IR-TAALFETSSMALLFEKCFTVSRRSLQRpdMSVGRIMNMVGNDVDNIGSLNWYVMYFWSAPLQLVLCLLLLIRLVGW 372  Leishmania tarent...
AFQ59574   78 -HM-LGINIETDMRKSLFDHLQKLSFKFYDN--NKTGTLMSKLTNDLMYIGEVAHHGPEDLFIAVMTILGAFGVMLFINW 153  Bacillus subtilis...
4M1M_A    852 QLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFETMYAQSLQIPYRNAMKKA 931  house mouse
P47261    168 VIALISLSILATLITFSFAFLKKSKTSYSQVQNNLGDMSGYIEEVLTNHKVVHVLKLQEIMIKDFDQYNKSMIKPTVRGN 247  Mycoplasma genita...
P26363    222 ASAFCGLGFLIILSLFQARLGRMMMKYKDKRAGKINERLVITSQIIENIQSVKAYCWENAMEKIIETIRETELKLTRKAA 301  African clawed frog
P26362    222 EFVFCGLGFLIMLALFQAWLGKKMMQYRDKRAGKINERLAITSEIIDNIQSVKVYCWEDAMEKIIDDIRQVELKLTRKVA 301  spiny dogfish
Q09427    459 S-ALIGAAVIILLAPVQYFVATKLSQAQRTTLEHSNERLKQTNEMLRGMKLLKLYAWESIFCSRVEVTRRKEMTSLRAFA 537  black-bellied ham...
P33527    465 SV-LAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKV-LKKS 542  human
Q10185    412 G-ALSGAFVTFLLFPCNVVIASIFKRFQNRQMKNKDARSQFMTEIINNIRSIKLYAWENIFLQKLLQLRNTRELRMLKKI 490  Schizosaccharomyc...
P39109    447 SM-WVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKL 525  Saccharomyces cer...
P21441    373 -LRVPGMAVLFVTLPLQAVISKHVQDVSERMASVVDLRIKRTNELLSGVRIVKFMGWEPVFLARIQDARSRELRCLRDVH 451  Leishmania tarent...
AFQ59574  154 QLALLTFIIMPIVIWLALYFNKKMTKAFTTLNKDIGDFSARVENNIGGIRLVQAFGNEAFEKERFAVNNQRFRVTKLSSY 233  Bacillus subtilis...
4M1M_A    932 HVFGITFSFTQAMMYFSYAAAFRFGAYLVTQ-Q---LMTFEN--VLLVFSAIVFGAM 982  house mouse
P47261    248 TYSIFLFSWFGFISNITYLVSISIATAFSVN-S---IPSFGIsvINYSFMLSYIASL 300  Mycoplasma genitalium G37
P26363    302 YVRYFNSSAFFFSGFFVVFLS-IVPHLLL---D---GISLRKifTTISFSIVLRMAV 351  African clawed frog
P26362    302 YCRYFSSSAFFFSGFFVVFLS-VVPYAFI---H---TIKLRRifTTISYNIVLRMTV 351  spiny dogfish
Q09427    538 VYTSISIFMNTAIPIAAVLIT-FVGHVSFFKeS---DLSPSVafASLSLFHILVTPL 590  black-bellied hamster
P33527    543 AYLSAVGTFTWVCTPFLVALCTFAVYVTIDEnN---ILDAQTafVSLALFNILRFPL 596  human
Q10185    491 GIVNTIGNFTWLFAPILVSAATF-GTFIVLY-GktrVLSVDIvfACLSLFNLLQFPL 545  Schizosaccharomyces pombe 972h-
P39109    526 GCYMAVTSFQFNIVPFLVSCCTFAVFVYTED-R---ALTTDLvfPALTLFNLLSFPL 578  Saccharomyces cerevisiae S288c
P21441    452 VANVFFMFVNDATPTLVIAVV-FILYHVSGK-----VLKPEVvfPTIALLNTMRVSF 502  Leishmania tarentolae
AFQ59574  234 KIMAKNGSISYMLTRFVTLFVLLCGTWFVIR-G---SLSYGEfvAFVLLTNVLFRPI 286  Bacillus subtilis QB928
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap