1BNB,1E4R,1E4T


Conserved Protein Domain Family
Defensin_beta

?
pfam00711: Defensin_beta (this model, PSSM-Id:279100 is obsolete and has been replaced by 395579)
Click on image for an interactive view with Cn3D
Beta defensin
The beta defensins are antimicrobial peptides implicated in the resistance of epithelial surfaces to microbial colonization.
Statistics
?
PSSM-Id: 279100
View PSSM: pfam00711
Aligned: 47 rows
Threshold Bit Score: 25.2919
Threshold Setting Gi: 253722818
Created: 10-Jul-2015
Updated: 5-Aug-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BNB_A        2 PLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCR 36  cattle
P46157       28 KSDCFRKNGFCAFLKCPYLTLISGKCSRFHL-CCK 61  chicken
Q6R953       34 HYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCI 68  pig
O89117       34 QYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCR 68  Norway rat
Q8R2I7       34 LARCYKFGGFCYNSMCPPHTKFIGNCHPDHLHCCI 68  house mouse
Q8R2I8       34 LTRCYKFGGFCHYNICPGNSRFMSNCHPENLRCCK 68  house mouse
Q7TNV7       26 TKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQ 60  house mouse
Q70KL2       26 TIKCLQGNNNCHIQKCPWFLLQVSTCYKGKGRCCQ 60  house mouse
Q7TMD2       26 TIACIENKDTCRLKNCPRLHNVVGTCYEGKGKCCH 60  house mouse
NP_001028029 34 HYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK 68  Rhesus monkey
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap