Conserved Protein Domain Family
Defensin_propep

?
pfam00879: Defensin_propep (this model, PSSM-Id:279251 is obsolete and has been replaced by 395707)
Defensin propeptide
Statistics
?
PSSM-Id: 279251
View PSSM: pfam00879
Aligned: 31 rows
Threshold Bit Score: 39.9228
Threshold Setting Gi: 118415
Created: 20-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0W9Q6        1 MRTLTLLAALLLLALQVQTQSLEETADQVPAQDQPGAEAQDMTISFAGDER 51  horse
P28311        1 MKTLVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSISFGGQEG 51  house mouse
Q4JEI2        1 MKTLILLSALVLLALQVQADPIQEAEEETKTEEQPADEDQDVSVSFEGPEA 51  Norway rat
Q4JEI9        1 MKTLVLLSALVLLALQVQAEPTPKTDEGTKTDEQPGKEDQVVSVSIEGQGd 51  Norway rat
Q5ERI8        1 MKTLVLLSALVLLAFYVQADSTQETDEETKTDDQPGEEDQGVSVSFEDPER 51  house mouse
P49112        1 MRTVPLFAACLLLTLMAQAEPLPRAADHSDTKMKGDREDHVAVISFWEEES 51  domestic guinea pig
XP_006161319  1 MKVLVLLAAIFLVAIQAQADPLPARTEEALDQEQFGAEDQDVPVDFTGDEG 51  Chinese tree shrew
ELV14234      1 MRTLTLISAILLVTLQAQADPLPDTSDEVQVQEQAAAENPDVAISFAGDEN 51  Chinese tree shrew
ELV14231      1 MKMLACLAAILLVVLQTQTDALPVGTEEDPVQEQTGAEDQDVTTHLTQTES 51  Chinese tree shrew
EGW04728      3 MRTLTLLVALLLLAFETRAEPFEGSAEELLDQDLLGEDDQDMSISFGGDER 53  Chinese hamster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap