2A85,2J6X


Conserved Protein Domain Family
FMN_dh

?
pfam01070: FMN_dh (this model, PSSM-Id:279418 is obsolete and has been replaced by 395850)
Click on image for an interactive view with Cn3D
FMN-dependent dehydrogenase
Statistics
?
PSSM-Id: 279418
View PSSM: pfam01070
Aligned: 179 rows
Threshold Bit Score: 140.366
Threshold Setting Gi: 501450424
Created: 21-Jun-2015
Updated: 5-Aug-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2A85_A        16 QKRLPK--MVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRR--SLQAEVLGKRQSMPLLIGPT--ALNGALW-P 88  Pseudomonas putida
O29451        67 RQILQErdVNIEVLEGGTERGLTVRRNREILDSIGIKMNLLSDFEP---SLETEFLGRKISMPVMPAPLs-GLVKSVD-A 141 Archaeoglobus f...
Q0UI74       122 KAVLPH--KSYVYVSTSANTGLSLQCNLDDWGRVSFRPRVMRNVGDV--DTRRKIFGHESPYPFYISPM--GTMGAIH-P 194 Phaeosphaeria n...
Q0CVD1         8 DKGIA---FNFPVFQSGAEDEFTVRWNKDSWRTIRFRPRVLRPIRSI--DLTTSILGTEYSVPFFICPA--GGGKLAH-P 79  Aspergillus ter...
Q2U134        88 SQVLAP--RSFAFFKPGANDEYTAQWNQE-----------------R---------GSKLTHPS---------------- 123 Aspergillus oryzae
Q2TXM6        54 RRYMNA--SSYTYYRNGAAGEWSYRNNLEAYGRFRFKPRMLVDVTNIesTLPTTILGHNFSAPFYISPC--ARGGLAH-P 128 Aspergillus oryzae
WP_015925772   2 KQNTPH-----NYRTGDSNE-----ITRQYFDSLLIEMRHIDSVIP---STTFELYGENFSTPIMTAAL--SHLNNSR-A 65  Clostridium cel...
WP_012159017  30 KGQVPG--------VGGKGSGSSFIRNWQKIQDVKINLDTIIEESPI--DTSIELFGQKFTYPVFAAPI--GAVGLNYsP 97  Alkaliphilus or...
ABX42618      34 RNQIPG--------PGAKGIGDTAIRNYDKWKEIRLNMDTLVAASNI--DTKRTIYGKEFAYPFFAGPV--GAISLHY-G 100 Clostridium phy...
WP_011877617  30 SGEVPG--------MGGTGTGVSFRNNLNALASYNLNMRTLHNAKNP--STETELFGVALTSPIMAAPMtgTPYNMGG-S 98  Desulfotomaculu...
2A85_A        89 K--GDLA----LA-RAATKAGI--PF----VLSTASNMSIEDL--------ARq--Cd-----gDLWFQLYVI---HREI 137 Pseudomonas putida
O29451       142 NcfKRII-------REAWEAGV--VP----WIGHPIQDDVSEF--------EK-----------EFVWIIKPLr--NTKR 187 Archaeoglobus f...
Q0UI74       195 N--GEPE----MY-KGALRKGI--HA----VVSTASSKSTEQImqafmeaqKKmsaSp-----tKLFFQYYMPv--DRKK 254 Phaeosphaeria n...
Q0CVD1        80 T--GEVL----LT-QAAGKHGV--LH----WVCNMAGCSQKQI--------ADargPa-----qTLYWQIYAMn--DLSV 131 Aspergillus ter...
Q2U134       124 ---GDLA----LT-QAAGKHDI--LD----WVPNNSGCTQKQL--------ANaraVs-----qTLYWQIYAMe--DLSV 174 Aspergillus oryzae
Q2TXM6       129 E--AEKN----FV-KAAYEEDI--LY----IPSLYASLSVEEI--------AA---AkpsngsqTIFQQVYLTe--NDTE 182 Aspergillus oryzae
WP_015925772  66 N--GMVE----MA-KGAMAANA--VM----WTGMGDDAELEAI--------TAt---------gAKTIKIIKPh-sDNNT 114 Clostridium cel...
WP_012159017  98 Al-DDFEytkaII-GGCKEAGVi-GFtgdgVKDEFYDLPLQVV--------KEnn--------gHGIPTIKPWk--KEEI 156 Alkaliphilus or...
ABX42618     101 DsyNDLTynevLV-KACADAGIa-AF----TGDGVNPEVMKAA--------TDc---------iKLVDGVGVPt--VKPW 155 Clostridium phy...
WP_011877617  99 LseKEFIsmivSGsKQAGTLGWtgDG----ADPEMYNSGLEAI--------TN-----------EQGYGIPIIkprEQNV 155 Desulfotomaculu...
2A85_A       138 AQGMVLKALHT--GYTTLVLTTDVAVNGYRE--RDLHNRFKIPPFltLK-------------NFEGIdlgkmdkanLEMQ 200 Pseudomonas putida
O29451       188 VYDDVEKAESS----KAMAIGMDIDSAA----------GIKVGGTilsyg-------gtkvwSKK--------------- 231 Archaeoglobus f...
Q0UI74       255 AMELLRIVKRC--DYKGLWITVDAPVLGKRTadRYLQAEEMLSMGlaeea--------taewETSGDn-------kFAPA 317 Phaeosphaeria n...
Q0CVD1       132 TEKEIKQAIAL--GYRGFALTVDAIWSGKRE--RDLRL--SVDGG--DDsdvdqdeeandgfASGPT------------- 190 Aspergillus ter...
Q2U134       175 TENEIKQAIAL--GYRAFALTVDAPRAGKRE--RDVRL--TIEvckcv---------tcasvVRTAL------------- 226 Aspergillus oryzae
Q2TXM6       183 TKQLFEKVEKL--GSKAIVFTVDSAADGNRH--RAARYGVgsa-----------------dsSYTYI------------- 228 Aspergillus oryzae
WP_015925772 115 IFKKIEHAEKC--GVLALGMDIDHSFNNKGE--FDNVLGLPMSGK----------------------------------- 155 Clostridium cel...
WP_012159017 157 IAK-IKKAEEN--GAPAVAMDIDAAGLVtlall------------------------gkpvgTKSIE------------- 196 Alkaliphilus or...
ABX42618     156 NLNTIKEKSQLikDCNAFAVAMDVDAAGlpflkn----------------------mqppagRKSVE------------- 200 Clostridium phy...
WP_011877617 156 IIECIGRAERA--GAKAVGVDIDGAGLVtmalk------------------------gqpvgPKSKR------------- 196 Desulfotomaculu...
2A85_A       201 A--ALMSRQMDASFNWE-A-LRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQSVAK 276 Pseudomonas putida
O29451       232 ------------------E-LADLASTTKLPFIVKGVLSERDYYSLADIS-SAIVVSNHGGRVLDSAISPLELLPYL-EK 290 Archaeoglobus f...
Q0UI74       318 MggRMVQGQLSPYMSWE-D-LAWIRKEWDGSIVLKGIQCAEDAKLAMEHGCDGILLSNHGGRQLHTAPSALMTLCEIRTY 395 Phaeosphaeria n...
Q0CVD1       191 ---VKRSPIW-TEFDWPsS-IAWLRKITNLPIAIKGIQSWEDAVLCMEYGVHP-WLSNHGGRQLEGAPSAVDTLLAIRKH 264 Aspergillus ter...
Q2U134       227 ---QCLGMKI--------T-VLPVARRSRGP--IKCIQSWEDAVLCMEHGVHP-WLSNHGGRE------SSEVF------ 279 Aspergillus oryzae
Q2TXM6       229 --------------TWD-Y-YKKLQNMTSLPVVLKGIQSVEDVKLAVAHGAPAVILSNHGGRQLDGTPSPLEIALEIHEE 292 Aspergillus oryzae
WP_015925772 156 --------------TLD-E-IKEFVNATKLPFVIKGVLSEKDIYKCLEAGVKGIVVSHHHG-IMDFAVPPLMVLPKIARV 218 Clostridium cel...
WP_012159017 197 ------------------D-LKEIISSTKLPVILKGVMTVEGAKKALKAGAYGIVVSNHGGRVLDHTPATIEVLPAIADA 257 Alkaliphilus or...
ABX42618     201 --------------ELR-EiIQQINR----PFIVKGVMTVKGAEKAFEAGASGILVSNHGGRVLDQCPSTAEVLEEIAKE 261 Clostridium phy...
WP_011877617 197 ------------------E-IKELVNATKLPFILKGIMTVDEAEMAVEAGVSAIVVSNHGGRILDFTPGAADVLPAIAAA 257 Desulfotomaculu...
2A85_A       277 TG-----KPVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPD 351 Pseudomonas putida
O29451       291 V------VPTGVDSGFRYGSDVFKALALGADFVLFGRLMVYALAI--ENGVQTALNMIRDELLRIMKLTGAKSVKEISKE 362 Archaeoglobus f...
Q0UI74       396 CPevmnkLEIFLDGGLRNGNDVLKALCLGATAVGVGRPFLYALGAYGSKGVEKCVDVLAKELRTGMRLLGITSLEQCRPE 475 Phaeosphaeria n...
Q0CVD1       265 CPqvfdrCEVIVDGGITRGADIVKALALGARAVGLGRGFLYA-LAFGERGVSRAIRILRHEVETTMALLGVTNLGQLNPS 343 Aspergillus ter...
Q2U134       280 -Rr----CEVIVDGGICRGADIVN---------------HYS-------------------------------------- 301 Aspergillus oryzae
Q2TXM6       293 APelfeqIEIYADGGIRYGADVLKLLALGVTAVGLGRPFMFA-NTYGVEGVKHAIQLLKHEIAIDAGNLGVGDLKKLDAS 371 Aspergillus oryzae
WP_015925772 219 VDr---sIPIFVDCGVASGIDVFKALALGADAVSVGLTLIPHLNEAGADGVQNVIEEMTQELAGVMARTCSKDIASIDSS 295 Clostridium cel...
WP_012159017 258 VKg---rMKIFVDGGFRTGLDIFKAIALGADAVLIGRPYAVAAYGGGAEGVKVYTEKIGNELKETMIMAGCHNLADIKRD 334 Alkaliphilus or...
ABX42618     262 FKg---kMTIFVDGGIRSGADLFKSLALGADAAIIARPFVTAVFGGGYEGVRSYIQKIGAELIDVMEMCGVSSLDEITSE 338 Clostridium phy...
WP_011877617 258 VKg---kVTILADGGVRTGVDVLKLLALGADGVLVGRPLVVGAFGGHTEGVKFLIEKMTSELKQAMILTGCNTIKEINDS 334 Desulfotomaculu...
2A85_A       352 YLQN 355 Pseudomonas putida
O29451       363 AVVL 366 Archaeoglobus fulgidus
Q0UI74       476 MVNA 479 Phaeosphaeria nodorum SN15
Q0CVD1       344 YVDV 347 Aspergillus terreus NIH2624
Q2U134       302 NIYR 305 Aspergillus oryzae
Q2TXM6       372 -YEP 374 Aspergillus oryzae
WP_015925772 296 VIWN 299 Clostridium cellulolyticum
WP_012159017 335 RVFL 338 Alkaliphilus oremlandii
ABX42618     339 CIWK 342 Clostridium phytofermentans ISDg
WP_011877617 335 VIYN 338 Desulfotomaculum reducens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap