Conserved Protein Domain Family
Clusterin

?
pfam01093: Clusterin (this model, PSSM-Id:279439 is obsolete and has been replaced by 395869)
Clusterin
Statistics
?
PSSM-Id: 279439
View PSSM: pfam01093
Aligned: 46 rows
Threshold Bit Score: 449.307
Threshold Setting Gi: 620962901
Created: 20-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P10909        30 ELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMAL 109 human
Q95KN1        33 NLKGFSEAGDIDVDEEVKKALIGMKQMKIMMERREEEHTNLMKTLKKCKEEKQEALKLMNEVQEHLEEEESLCQVSLTDS 112 dog
Q15846        33 NLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADS 112 human
XP_001493067  33 HLKGFSDAGEIDVDEEVKKALIGMKQMKIMMERREEEHTHLMKTLKKCREEKQEALELMNEVQEHLEEEERLCQASLTES 112 horse
XP_012657499  33 NLKSFSAAGETHVDEEVKKALMGIKQMKTVMEKKEEEHSNLMKTLKKCREEKQEALKLMNEVQEHLAKEERLCHVSLAES 112 small-eared galago
EHB12688       3 aLSGFSEAEEIDGDGEVKKALIGIKQMKIMMERRGEEHTKLVKTLKKCKEEKQEALKLMNEVQEHLKKEESLCQVFLADS 82  naked mole-rat
XP_008259348  33 NLKSFSEAGEIDEDEAVKMALIGIKQMKIMMERREEEHTKLMKTLKKCREEKQEALKLMNEVQDHLEEEERLCQVSSADS 112 rabbit
XP_006102209  33 spKGFSEPGDTDVGEEVKKALIGMKQMKTMMERREEEHTNLMTTLKKCRVEKQEALKLMNEVQEHLEEEERLCQESLTDS 112 little brown bat
XP_005329078  33 NLKSFSEAGETDGDGEVKKALIGIKQMKLMMERREEEHTKLMTTLKKCKEEKQGAVKLMNEVQEHLEEEERLCQASLADS 112 thirteen-lined ...
XP_003474165  33 NANSFSEAGEIDVDGEVKIALIGIKQMKIMMERREEEHSKLMKTLKKCKEEKQEALKLMNEVHEHLEEEESLCQVSLADS 112 domestic guinea...
P10909       110 WEECKPCLKQTCMKFYArVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLL--ENDRQQTHMLDVMQDHFSRASSII 187 human
Q95KN1       113 WDECKSCLESNCMRFHT-TCQPSWSSMKNTVEQFFRNIYQYLFPFDEDNEKDLPvgEKFIEEDAQVAQIENVFNQLTVDV 191 dog
Q15846       113 WGECRSCLENNCMRIYT-TCQPSWSSVKNKIERFFRKIYQFLFPFHEDNEKDLPisEKLIEEDAQLTQMEDVFSQLTVDV 191 human
XP_001493067 113 WGKCKSCLESSCLRFYT-ACQPRWTSMKNTVEQFFRKIYQFLFPFHEDNEQDLPvgEKVIEEDAQLTQIENVFSQLTVDV 191 horse
XP_012657499 113 WDECRSCLESDCMRFYT-NCQPSRSSVKNTIGQFFRKIYQGLFPFREDDETDLPisEKFPEEDSQLTHMEDVFSQLAVDV 191 small-eared galago
EHB12688      83 WDECRACLESNCMRFYG-TCQPAWSSVKNTVEQFFRKIYQFLFPLQENGGSYVPvsQGLTEEDTQVSHMEHVFSQLTEDV 161 naked mole-rat
XP_008259348 113 WDECRSCLESDCMRFYT-TCQPRWSSVKNTIEQFFRKIYQFLFPFHEDNEKDLSasEKYIEEDEQLVQIEGVFSQLSVDV 191 rabbit
XP_006102209 113 WDECKSCLQSDCVRFYT-THQPSWSSMGNVIGQFFRKIYQFLFPLHEEKEKELPvaEKVLEEDAQVTQIEHMFSQLTVDV 191 little brown bat
XP_005329078 113 WEECRTCLDSNCMRFYS-TCQPGWSSVKNTVEQFFRKIYQFLFPLHHDEHSHLPssEQHTQEDAQVTHMEKAFLQLTATA 191 thirteen-lined ...
XP_003474165 113 WDECRACLESNCMRFDT-TCQPAWSSVKNMVEQFFRKIYQFLFPLQENDRSG-PvsKGVTEEDAQVSHIEHVFSQLSADV 190 domestic guinea...
P10909       188 DELFQDRFFTREPQDTYHYLPFslphrr-------------phfffPKSRIVRSLmpfspyeplNFHAMFQPFlEMIHEA 254 human
Q95KN1       192 RFLFNRSLNVFKQMQQEFDQTFqsyfmsdtdlmqpnflpalskeprKKADPVQSW---------DIPSFFQLFyNFSLSI 262 dog
Q15846       192 NSLFNRSFNVFRQMQQEFDQTFqshfisdtdltepyffpafskepmTKADLEQCW---------DIPNFFQLFcNFSVSI 262 human
XP_001493067 192 RFLYNRSFNVFKQMQQEFDQAFqsyfmsdtdliepyffpalskeptKKSNLVQSW---------DIPSFFQLFcNFSVSI 262 horse
XP_012657499 192 KSLFNRSLNVFKQMQQEFDQAFqsyfmsdtdfiessfspalskeptKKEDFVQNW---------ALPNFFQLFcNFSLSI 262 small-eared galago
EHB12688     162 TALFNRSVYIFRQMQREFDQGFqsyfmsdadvpepyffpalleepaKKADVGQSW---------AIPNVFQLLqNFSLSI 232 naked mole-rat
XP_008259348 192 KSLFNRSVSVFKQMQQEFDEAFqlyfmsdtdliepyffpalskepmQKAGLVQNW---------NIPDFFQMFrNFSVSI 262 rabbit
XP_006102209 192 RCLFNRSFNVFKQMEREFDQAFrsyfmsdtdviepyvfpalfkeptKKADLVQSW---------DGPGLFQLFcDFSLSI 262 little brown bat
XP_005329078 192 ESLFNRSLSVFKQMQQEFDQAFqsdfmsetnlmephlfpalskeptEKADLGQSW---------DIPNFFQLFcNFSRSI 262 thirteen-lined ...
XP_003474165 191 TSLFNRSLYVFKQLRREFDQAFqsyftsgtdvtepfffpslskepaYRADAEPSW---------AIPNVFQLLcNLSFSV 261 domestic guinea...
P10909       255 Qqamdihf---------------hspafqhPPTEFIREGDDD-RTVCREIRHNSTGCLRMKDQCDKCREILSVDCstnnP 318 human
Q95KN1       263 Yhsisttitktlna----iedlpkqdndsnHGSLSSKTLPVQhRGPYGEFGQNLSECFQFHARCQKCQDYLWEDC----P 334 dog
Q15846       263 Yesvsetitkmlka----iedlpkqdkapdHGGLISKMLPGQdRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDC----P 334 human
XP_001493067 263 Yqsvsatitetlna----iedfpkqdkdsdRGGPSSKMLPVGdRGLCGDLGQNLSECFQFHARCQKCQDYLWEDC----P 334 horse
XP_012657499 263 Yesvsetitealna----iedlpeqdkgpdQGHL---MLPAQdRRLCGELGQNSSECFKFHERCQKCQDYLSEDC----P 331 small-eared galago
EHB12688     233 Ydsirekitktlca----tedllkqdkdsnQGGPISKILPEQnRGLCGDLGQNLSGCFNFSKRCQKCQDYLSEDC----P 304 naked mole-rat
XP_008259348 263 Yesvsgaitetlta----vqdspkqgkdpgHGRLASKMLPEQdRQPCGELSQDLSGCFRFHQRCQKCQDYLAKDC----P 334 rabbit
XP_006102209 263 Yrslsttvtetln-----amedrpkhqdadPGGLSSKTVPVWnRGPCGELGQNSSECFHCHARCQKCQDYLWEDC----P 333 little brown bat
XP_005329078 263 YeslreavthtlraiedspkhdegsdqgtqQGGLISKTLSEQdKGPCAELGQNFSGCFRLQEKCQKCQDYLSEDC----P 338 thirteen-lined ...
XP_003474165 262 Yqsvseklittlra----tedppkqdkdsnQGGPISKILPEQdRGSDGKLGQNLSDCVNFRKRCQKCQDYLSDDC----P 333 domestic guinea...
P10909       319 SQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYlRVTTVA---SHTSD 395 human
Q95KN1       335 DVPELHTKVDEALELVNISHQQYAQVLQMTQHHLEDTTYLMEKMREEFGWVADLANQAPGAENIF-DSTKMV---PNIHE 410 dog
Q15846       335 DVPALHTELDEAIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIIF-NSIQVV---PRIHE 410 human
XP_001493067 335 DVPELHSKVDEALKLVNISNQQYTQVLQMTQQHLDDTAYLMERMREQFGWVTELANQTPGTENIF-NSIEVI---PGVPE 410 horse
XP_012657499 332 DVPELHAELDEALRLVNVSSQQYTEVLRMTQQHLEDTSYLMERMRWQFGWVSELANQIPETEIIF-NSIKVV---PSVRE 407 small-eared galago
EHB12688     305 AVPELHIELNEALRLVNISNQQYDQIMQMTQYHLEGTTYLMEKMREQFGWVSELANQSSGAENVF-NPIKVVmvaPSVHE 383 naked mole-rat
XP_008259348 335 NVPELHTELEEALKLVNVSNEQYAQILRMAQYHVEDTMYLMEKMRAQFSWVSDLANQTTPTENAF-NSTKED---PSVRE 410 rabbit
XP_006102209 334 DVPELHTEVDEALKLVNISDQQYVQILQVTQHHLEDTAYLMEKMREEFGWVAELANQTLGTENTF-SSRKVV---PDVHQ 409 little brown bat
XP_005329078 339 DVADLHIELDKALRLVNVSNEQYDQVVQMIQHHLEDTMDLMERMSQQFGWVSELANQSLGAENIF-NSIKAV---PRAHE 414 thirteen-lined ...
XP_003474165 334 NVPELYRELNEALRLVSRSNQQYDQVVQMTQYHLEDTTLLMEKMREQFGWVSELAYQSPGAEDIF-NPVKVA---LSAHE 409 domestic guinea...
P10909       396 SDvp-sGVT-EVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKK 445 human
Q95KN1       411 GNfskqDET-MIDLSILSSPNFTLKIPLEESAETSNFISYMLEKAVQHFKKH 461 dog
Q15846       411 GNiskqDETmMTDLSILPSSNFTLKIPLEESAESSNFIGYVVAKALQHFKEH 462 human
XP_001493067 411 GNfskrGDM-TIDFNILPSPNVTLKIPLEESAENSNFLSHVLAKAVQHFKEH 461 horse
XP_012657499 408 DNfskqNET-----SILPSSNFTLKSPLEESAESSNVIGYLVAKALLHIKKH 454 small-eared galago
EHB12688     384 GNssnqDAS-R-----LPAPHFTLRSPLDQGADDSNFTDYMAEKALQYFREH 429 naked mole-rat
XP_008259348 411 RTstrqGEM-KVDFSILPSPNSTLKMLLEESSESSSFVDYIAAKVRQHFKEH 461 rabbit
XP_006102209 410 GNiskqDET-MIDLSILPSPNVTLKIPLEESSESSNFVSYVLEKAVQHLKEH 460 little brown bat
XP_005329078 415 GNsskqDDP-VVESSILPSPKSALGIPLEESAESSNFIDYVVTKVLQHLKEr 465 thirteen-lined ground squirrel
XP_003474165 410 GNssdqDDT-VVPSSLLPSSNFTLSSPLEKSAGNANFIDHVVEKVLQHFKEH 460 domestic guinea pig
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap