Conserved Protein Domain Family
KRAB

?
pfam01352: KRAB (this model, PSSM-Id:279668 is obsolete and has been replaced by 396083)
KRAB box
The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.
Statistics
?
PSSM-Id: 279668
View PSSM: pfam01352
Aligned: 822 rows
Threshold Bit Score: 39.2528
Threshold Setting Gi: 514444854
Created: 22-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8C393        51 IFKDVAVYFSQKEWQLLEPAQKDLYKDVMLENYENLISV 89  house mouse
XP_012401279   9 TFKDVSVDFSRSEWKQLKPAQKELYRDVMLENYKNLVSL 47  Tasmanian devil
XP_007082427  15 KFKDVAVKFSKDEWKQLVPTQRALYREVMLENYQGFVSL 53  Amur tiger
XP_006144781  28 TFKDVAIEFSKTEWKRLDPAQRALYREVMLENYRNLVSV 66  Chinese tree shrew
XP_007489629 181 TFKDVAVMFSRKEWWHLQPTQMELYRDVMLENYRNMVSV 219 gray short-tailed opossum
NP_112234     25 TFRDVAIEFSLAEWKCLNPSQRALYREVMLENYRNLEAV 63  human
XP_008986817   9 TFKDVSVEFSSAEWKCLTPAQRALYRDVMLENYRNLESV 47  white-tufted-ear marmoset
XP_516348     25 TFRDVDIEFSLEEWKCLDHTQRALYRAMMLENYRNLHSV 63  chimpanzee
XP_012320743  38 lFRDVAIVFSQEEWQWLAPAQRDLYRDVMLETYSNLVSL 76  Ma's night monkey
XP_006106244  28 TFRDVAIDFSQEEWAWLQPAQRDLYRHVMLENYGHLVSL 66  little brown bat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap