Conserved Protein Domain Family
Myosin_tail_1

?
pfam01576: Myosin_tail_1 (this model, PSSM-Id:279860 is obsolete and has been replaced by 396244)
Myosin tail
The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.
Statistics
?
PSSM-Id: 279860
View PSSM: pfam01576
Aligned: 18 rows
Threshold Bit Score: 1142.55
Threshold Setting Gi: 736187973
Created: 7-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6URW6        869 TRQDEVLQARAQELQKVQELQQQSAREVGELQGRVAQLEEERTRLAEQLRAEAELCSEAEETRARLAARKQELELVVTEL 948  house mouse
XP_005620093  948 TRQEEELQAKDEELLKVKERQTKVEGELEEMERKHQQLLEEKNILTEQLQAETELFAEAEEMRARLAAKKQELEEILHDL 1027 dog
XP_008115388  888 TRQDEVMQAKAVELQKVQEKHTKTQMDLKELENKYQQLSEEKTILAEQLQAETELFAEAEEMRARLAARKQELEDILHEL 967  green anole
NP_001095597  848 TRQEEEMQAKEDELQKTKERQQKAESELKELEQKHSQLTEEKNLLQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEM 927  cattle
XP_012822870  865 TRQDEVMQAKVVELQKVKDTQVKTESELKEMANKYQQLFEEKSILAEQLQAETELFAEAEEMRARLASKKQELEEILHDL 944  western clawe...
XP_009297903  865 TRQEEEMNQIEEELQKAKEIAQKSETELKEITQKHDQVVEERNKLQAKLQEEAELYAESEEVRIRLETKKQELEEVLHEM 944  zebrafish
XP_011476026  861 TRQEEEMGQKEEELKAVREAAAKAEADLKDITQKHSQLVEEQAMLEAKLQAEAELYAEAEDMRVRLEAKKQELEEVLHEM 940  Japanese medaka
XP_009860140  849 TRQEEDLNAKERELKLVQEKKDELESSLHDIEKKFAQVCEEKNMLAEQLQTEQEVWNESEEMRARLAARKTELEEILQDM 928  vase tunicate
XP_009290473  913 TRQDEEIQAREAQLQKAKDKLSKLELDFTELDKKNQQLIEEKSVLTDQLQAEAELFAEAEEMRARLANRKQELEDVLGEL 992  zebrafish
XP_010770599   20 TRQEEEMGQKDDELKSAKEVALKSEAELKDISQKHTQLMEERTLLETKLQAETELYAEAEEMKLRLETKKQELEEVLHEM 99   black rockcod
Q6URW6        949 EARVGEEEECSRQLQSEKKRLQQHIQELESHLEAEEGARQKLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSKERRLLEER 1028 house mouse
XP_005620093 1028 ESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDR 1107 dog
XP_008115388  968 ESRVEEEEERCQQLQGDKKKMQQHVQDLEEQLEEEEAARQKLQLEKVSTEAKLKKMEEDLLVLEDQNSKLHKERKLMEER 1047 green anole
NP_001095597  928 EARLEEEEDRSQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDDILVMDDQNNKLSKERKLLEER 1007 cattle
XP_012822870  945 EARVEEEEERTLQLQNEKKKMHQHIQDLEEQLEEEEGARQKLQLEKVTTESRLKKMEEDILLLEDQNAKLAKERKLLDDR 1024 western clawe...
XP_009297903  945 EARLEEEEERSQAFQQEKGNLQQKLKELENHLAEQDATRQKLQLESGAADGKIKKLEEDVLIMEDQKNKLQKEKQQLEER 1024 zebrafish
XP_011476026  941 EARLEEEEERSISLQQEKKEMEQELQLMEAHIVQEEDARQKLQLEKAAVEGRVKKLEENLLLSEDQNNKLQKERKLLEER 1020 Japanese medaka
XP_009860140  929 EARLDEEEDRNQGMMQEKKKMQTNIKDLEEQLDEEEAARQKLQLEKVTLDAKCKKMDEDLNLLEDAQSKLQRERKALEER 1008 vase tunicate
XP_009290473  993 ESRLEEEEERTVQLTNEKKRIQQHVQDLEEQLEEEEGTRQRLQLEKVTLESKVKSLEAETLTLAEQRDRLSKEKKQLEER 1072 zebrafish
XP_010770599  100 EARLEEEEDRSHALTQERKETEQQLQLMEAHIAEQEDSCQKLQLEKASVEGKVKKLEEDVLVMEDQNNKLQKERKLLEER 179  black rockcod
Q6URW6       1029 LAEFSSQAAEEEEKVKSLNKLRLKYEATISDMEDRLKKEEKGRQELEKLKRRLDGESSELQEQMVEQKQRAEELLAQLGR 1108 house mouse
XP_005620093 1108 IAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAK 1187 dog
XP_008115388 1048 LSEFTSHMAEEEEKVKSLSKLRNKYEAVMADMEDRLKKEEKGRQELEKLKRKLDGEAGDLQEQVAELQQQLEELRQALAR 1127 green anole
NP_001095597 1008 ISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLDGEASDLHEQIAELQAQIAELKMQLAK 1087 cattle
XP_012822870 1025 IGEFTSTMAEEEEKVKSLNKLRNKYEAVIADLEDRLKKEEKGRQEMEKMKRKLDGETTDLQDQLLELQQQIEELKQQLAR 1104 western clawe...
XP_009297903 1025 LADFSSNLAEEEEKSKNLTKLKAKHESMISDLEVRMKKEEKSRQDVEKAKRKLETEHSDLQEQMKNLQTLIAELKTQQAR 1104 zebrafish
XP_011476026 1021 LADMSSNLAEEEEKSKNLSKLKSKHESMISELEVRLKKEEKTRQDVEKAKRKVEAELVDLQEQQADLQAQLAELRAQLAA 1100 Japanese medaka
XP_009860140 1009 VNELEGTLGDEEEKAKMLSKLKHKNESVISDLQERLKKEEKLRQELEKIKRQLEAEIAELREQIADLQLQLEELRVQNQR 1088 vase tunicate
XP_009290473 1073 LNEVTDQLTEEEEKVKSLNKLKNKQEAVIADIEERLKREEQGRLEQEKWKRRMEGEAVEAQEQLSDMSLLVTELRGSLSQ 1152 zebrafish
XP_010770599  180 MSDMNSNLTEEEEKSKNLTKLKTKHESMISDLEVRMKKEERGRQDVEKAKRKVEAELADLQEQNADLQNQLAELRAQLAA 259  black rockcod
Q6URW6       1109 KEDELQAALLRAEEEGGARAQLLKSLREAQAGLAEAQEDLEAERVARAKAEKQRRDLGEELEALRGELEDTLDSTNAQQE 1188 house mouse
XP_005620093 1188 KEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQE 1267 dog
XP_008115388 1128 KEAELQAALARVEDEAAQKNAVLKSLRELQAQLAELQEDMESEKLARAKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 1207 green anole
NP_001095597 1088 KEEELQAALGRLDDEMAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQE 1167 cattle
XP_012822870 1105 KEEELQAALARVDDEVGQKNNLLKQLRDLQSQLAELHEDLESEKAARAKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 1184 western clawe...
XP_009297903 1105 SEMEIQELQASVEAESTQKSNALKKIHEMEGLLSELQDELEAEQGAGRKSEKARKELEEELSALRTELEDSLDTTAVQQE 1184 zebrafish
XP_011476026 1101 KEEELQTTQACLDEESRQRGAALKRVRDLEALLAELQEDLEAEKVARGKAEAARRDLGEELNSLRSELEDSLDTTAAQQE 1180 Japanese medaka
XP_009860140 1089 KDDELAALQDKFDQEQTARSQLAKNHRELQNQNAEVLEDLEQERSQRNKAEKQKRDLSEELEALKTELEDSLDTTNAQQE 1168 vase tunicate
XP_009290473 1153 REKEITTLQTRLEEEGARRTEAQRALREAMSQVSELKEEVENERGMRERAEKQRRDLGEELEALRTELEDTLDTTAAQQE 1232 zebrafish
XP_010770599  260 KEEELEATQARLEEECNQRGAAVKRVRELEALLSELQEDLEAERGARGKVEAARRDLGEELNALRTELEDSLDTTAAQQE 339  black rockcod
Q6URW6       1189 LRSKREQEVTELKKALEEESRAHEVSMQELRQRHSQALVEMAEQLEQARRGKGVWEKTRLSLEAEVSELKAELSSLQTSR 1268 house mouse
XP_005620093 1268 LRTKREQEVAELKKALEEETRSHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVK 1347 dog
XP_008115388 1208 LRSKREQEVTELKKTIEEEVKVHEAQVLDMRQRHTSALEELSEQLEQSRRFKINLEKTKQALEGENAEMQKEVKLLQAAK 1287 green anole
NP_001095597 1168 LRAKREQEVTMLKKALDEETRSHESQVQEMRQKHTQVVEELTEQLEQFKRAKANLDKNKQALEKENAELAGELRVLSQAK 1247 cattle
XP_012822870 1185 LRAKREQEVTDLKKTIEEDVKVRDAQVTEMRQRHNQVVEEISEQLEQARRFKGNLEKVKQTLESENTDLIKEVKNLQAAK 1264 western clawe...
XP_009297903 1185 LRAKREQEVAMLKKLIEDEGRSHEAQVHELKQKHAQAVDELSQQLDQSKRAKATLEKAKQALEKEVGDLNGNLRSLGNAK 1264 zebrafish
XP_011476026 1181 LRVKREQEMAMLKKAMEDEGRSHETQIQELRQKHGQAVEELREHLEQAKKVRAALEKAKQALEKEAADLSADLRALSSTK 1260 Japanese medaka
XP_009860140 1169 LKSQRERELENLKRTLESETTSFDTQLQQMRQKHNSQVETFQDELDVLKRNKSALEKSKHSLESENQELQEELRLVSGAK 1248 vase tunicate
XP_009290473 1233 LRSRREAELGELQRCLEEETRRHEAQLSELRIKHTAAIDSLQEQLDNAKRSRQSLEKAKAVLEEERLNLSAELKTLQGGK 1312 zebrafish
XP_010770599  340 LRAKREQEVALLKKATEDEGRGHEAQVQDLRQKHSQAVEELNEQLEQAKRVRAGLEKAKQALEKEQADLSADLRSLGSSK 419  black rockcod
Q6URW6       1269 QEGEQKRRRLESQLQEVQGRSSDSERARSEAAEKLQRAQAELESVSTALSEAESKAIRLGKELSSAESQLHDTQELLQEE 1348 house mouse
XP_005620093 1348 AESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSSLLEEAEKKGIKFAKDAASLESQLQDTQELLQEE 1427 dog
XP_008115388 1288 LESEQRRKKLEGQVQELQLRAGEGERAKAELVERLVKLQNELDGVSGTLGSTESKTIKLAKDLATVESHLQDTQELLQEE 1367 green anole
NP_001095597 1248 QEVEHKKKKLEVQLQELQSKYSDGEKVRAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLGSQLQDTQELLQEE 1327 cattle
XP_012822870 1265 QDSEQRRKKLEQQVSEFQIRTNESEKVKFELAEKLQKLQAELDGVSGALGSTEGKSIKLTKDLSTVQSQLQDTQELLQEE 1344 western clawe...
XP_009297903 1265 QDLEQKKKKVETQLADLQTRFNESERKREELGDAVSKLNTEYNNVNSILNEAESKNIKLSKDVVSLNSQLQDAQELLAEE 1344 zebrafish
XP_011476026 1261 QDVEQKKKKVEAQLNDLQLRFSESERQRNELSERVSKMTVELDSVTGLLNEAEGRNIKLSKEASSISSQLQDAQELLSEE 1340 Japanese medaka
XP_009860140 1249 TDSETKRRKQDQQLQELSAKLQDTERQRNDLQDKLSKGQLEIESLSHNLEQVETQLSRSQKEASQLDSQLQDAQSQGQEE 1328 vase tunicate
XP_009290473 1313 MESERGRKRAEGQLQELNARLSQAEREREEREERLGKLQSELESLSSSLSSSDSKSHRLHKEVSSLESQLHDVQELLQEE 1392 zebrafish
XP_010770599  420 QDVEHKKKKAEAQLNDLNGRFSESERQRTELGERVSKMTMELDGVTGLLNDAEGKNIKLSKDVSSLSSQLQDAQELLSEE 499  black rockcod
Q6URW6       1349 TRAKLALGSRVRALEAEAAGLREQMEEEVVARERAGRELQSTQAQLSEWRRRQEEEAAVLEAGEEARRRAAREAETLTQR 1428 house mouse
XP_005620093 1428 TRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLVLQSQLADTKKKVDDDLGTIESLEEARKKLLKDVEALGQR 1507 dog
XP_008115388 1368 TRQKLNLSSRVRQLEEEKAAMLEQLEEEEAAKANFSRQMQSLQQQVMETKKKLEEDAGVAEAIEEARRRAAKDLESLSVR 1447 green anole
NP_001095597 1328 TRQKLNVSTKLRQLEDERNSLQEQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVELLEEGKKKFQKEIESLTQQ 1407 cattle
XP_012822870 1345 TRQKLNFSSRVRQLEEEKNNLMENLEEEESAKAQLSRQLQALQQQLLESKKRMEDQGGMVEAMEEAKKKSYKELEFLQQR 1424 western clawe...
XP_009297903 1345 TRQKLNFSTRLRQMEDERNGLLEQIDEETEARRNVERHVSSLNTQLSEAKKRLDEYSSNFQMLEESKKRLQRDLEATKGE 1424 zebrafish
XP_011476026 1341 TRQKLNLSGRLRQLEEDKGCLMEQLEEEMEAKQAVERQASSLSVQLSDLKKRLEELSAAVELLEEGKKRLQRELEAASGD 1420 Japanese medaka
XP_009860140 1329 TQAKLKYAHKIRSLEDERTSLEEQLEEEEESRKAVEKQLSTANIALQDLKKKMEGDAEAIDQLEESKKRYQRELEDKTQQ 1408 vase tunicate
XP_009290473 1393 TRQKLALGSRVRALEEEKAGLMERLEEEEEKTRELTRQIQNHTQQLADLKRQTEEVNSAVEAGEETRRKMQRDLENAVQR 1472 zebrafish
XP_010770599  500 TRQKLNVSGRLRQMEEDRNSLMEQLEEEMEGKRAVERQLSSLSMQLSDYKKKLEEASGAVEMLEEGKKRLQRDLEAASSE 579  black rockcod
Q6URW6       1429 LAEKTEAVERLERARRRLQQELDDATVDLGQQKQLLSTLEKKQRKFDQLLAEEKAAVLRAVEDRERIEAEGREREARALS 1508 house mouse
XP_005620093 1508 LEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQIASNLEKKQKKFDQLLAEEKNISARYAEERDRAEAEAREKETKALS 1587 dog
XP_008115388 1448 YEERVQACDKLEKGRTRLQQELDDVTVALDQQRQVVSALEKKQKKFDQMLAEEKLISARYAEERDRAEADAREKETKVLS 1527 green anole
NP_001095597 1408 YEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQLLAEEKNISSKYADERDRAEAEAREKETKALS 1487 cattle
XP_012822870 1425 FDEKHQINDKLEKTRNRLQQELDDLMVDLDHQRQIVSNLEKKQKKFDQMLAEEKNISARYGEERDRAEAEAREKETKALS 1504 western clawe...
XP_009297903 1425 LEEKTASYDKSEKTKNHLQQELDDVLLDLDNQRQLVSNMEKKQRKFDQMLADEKTLSSKYSQERDCAEAEAREKETKCLA 1504 zebrafish
XP_011476026 1421 YEEKAAAYDKLEKSRGRLQQELEDVLMDLDSQRQLVSNLEKKQKKFDQMLAEERAVSAKSAEERDRAEAELREKETKVLA 1500 Japanese medaka
XP_009860140 1409 LEEKSAQADKLEKTNKRLQGDYDDLSVEVDHNRSVISSLEKKQRQFDKALADERMISAKNAEERDQAEREAREKDTKAIS 1488 vase tunicate
XP_009290473 1473 EKSKEEEKERIERQKERLREEIEDMTIALQRERQNCTALEKRQKKFDQCLAEEKAVSARLQEERDRAEAESREKETRFLS 1552 zebrafish
XP_010770599  580 YEEKAAAYDKLEKSRSRMQQELEDVLMDLDGQRQAVSNLEKRQKKFDQMLAEERAVSCKFAEERDRAEAEVREKETRLLS 659  black rockcod
Q6URW6       1509 LTRALEEEQEAREELERQNRALRAELEALLSSKDDVGKNVHELERARKAAEQAASDLRTQVTELEDELTAAEDAKLRLEV 1588 house mouse
XP_005620093 1588 LARALEEALETKEEFERQNKQLRADMEDLISSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEV 1667 dog
XP_008115388 1528 LSRALEEALETREEMERQNKQLRAEMDDLVSSKDDVGKNVHELERFKRALEQQVQEMRAQMEELEDELQATEDGKLRLEV 1607 green anole
NP_001095597 1488 LARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEV 1567 cattle
XP_012822870 1505 LSRALEEAIDLKDELDRQNKQLRAEMDDLVSSKDDVGKNVHELERSKRALEQQVQEMKTQIEELEDELQAIEDGKLRLEV 1584 western clawe...
XP_009297903 1505 LTRALEECQGSLRELEKLNKTLRTDMEDLISSKDN--KNAHELEKTKRALEAQVEEMTIQMEELEDELQAAEDAKLHLEV 1582 zebrafish
XP_011476026 1501 LMKMLEDKQEALQEAERTVKALRVEMEDLISSKDDVGKSVHDLERAKRGLEAFVEEMKTQMEELEDELQVAEDAKLRLEV 1580 Japanese medaka
XP_009860140 1489 LSHECDELKDKIDELERVRRSQQAELDELVSSKDATGKSAHELERSKRLLESQMEEMKTQLEELEDELQVTEDAKLRLEV 1568 vase tunicate
XP_009290473 1553 LSRALQEATEQRDELERTNKQLRLEMEQLVNAQDDVGKNVHELERSRRALETEAQSLKEQTQELEDELGEAENARLRLEV 1632 zebrafish
XP_010770599  660 LARALEDSQDALEEAEKTTKGLKAEMEDLISSKDDVGKSVHDLEKAKRGLEAMADEMRMQMDELEDELQVAEDAKLRLEV 739  black rockcod
Q6URW6       1589 TVQALKAQHERDLQGRDDAGEERRRQLAKQLRDAEVERDEERKQRALAMAARKKLELELEELKAQTSAAGQGKEEAVKQL 1668 house mouse
XP_005620093 1668 NMQAMKAQFERDLQTRDEQNEEKKRLLVKQVRELEAELEDERKQRALAVASKKKLEIDLKDLEAQIEAANKARDEVIKQL 1747 dog
XP_008115388 1608 NMQALKAQHERELQNRDDANDDKKKLLSKQVRELEAELDAERKQRAQALAGRKKLELDLQEAMAQLDAANKGRDEAGKQL 1687 green anole
NP_001095597 1568 NMQALKVQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAVAAKKKLEGDLKDLELQADSAIKGREEAIKQL 1647 cattle
XP_012822870 1585 NMQAMKAQFERDLQNRDDSNDEKKKLLFKQVREMEVELEEERKQKSQILVAKKKLEMDLQDMESQMDSANKGRDEAVKQL 1664 western clawe...
XP_009297903 1583 NMQALKVQIQRDIQGREEQSEEKRKQLLKQVRELEAELEDEQKMRTSLAAAKKKLEGDLQDLEDQVDVNSRARDEAVKQL 1662 zebrafish
XP_011476026 1581 NSQALRAQHERELQAREEQGEEKRRQLLKQVRELEAELEEERKQRTLASAARKKLEGEVKNTEEQLEAASRGRDEALKQL 1660 Japanese medaka
XP_009860140 1569 NLQAAKTNFERDLNAREEQAEEKRRSILKQLRELEAELEEERKQKSNAIAAKKKMEMDFSDLESHIDAASKGKEDAVKQL 1648 vase tunicate
XP_009290473 1633 TLQALRAQFEREISTKEEKGEEKRRALNKQVRELETMLEEEKTQRAQALTVKKQLETELQEAEAQVEAANRGREEAFRQM 1712 zebrafish
XP_010770599  740 NIQALRAQHERELHGRDELGEEKRKQLVKQVRELESELEEERKQRGQASGSKKKLEGELKDMEDQLEASSRARDEAVKQL 819  black rockcod
Q6URW6       1669 KKMQVQMKELWREVEETRSSRDEMFTLSRENEKKLKGLEAEVLRLQEELAASDRARRQAQQDRDEMAEEVASGNLSKAAT 1748 house mouse
XP_005620093 1748 RKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSAL 1827 dog
XP_008115388 1688 RKLQAQMKELWREVEEARAAREEIFIQSRESEKKLKNLEAELLQLQEDLAASERAKRQAQQERDDLADELANGNSGKSAL 1767 green anole
NP_001095597 1648 RKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKDELAEELASSVSGRNAL 1727 cattle
XP_012822870 1665 KKLQLQFKEVWREVEETRAARDEIFVQSRDNEKKLKSLEAELLQLQEDLAAAERAKRQAQQERDDLADELSNGVSGKSAL 1744 western clawe...
XP_009297903 1663 RKIQTQMKDYQRELEDARASHKEVLSDARESERKARAMEAEILHLHEELASAEKARKHAERERDEIAGEMASGSFGKSGT 1742 zebrafish
XP_011476026 1661 RKNQGQLKELHRELEEGRAAHKEILASAREAERRCKNLEAEILQMQEMLAAAERARKQAETERDELSEEVAGGSSGRSLL 1740 Japanese medaka
XP_009860140 1649 KKAQAQLKEYQRDLDEVRQSRDDLLITSRESDKKAKNLEADLMQAQEDLSASERHRRTVEAERDELQEEIAGGLKDKNAQ 1728 vase tunicate
XP_009290473 1713 KRLQTQMKELIRELDETKLARDEIVAQSKDSEKRLQTLEAELLQLTEDLSVSERQKRQAQQERDEMADEIINNATGKSAL 1792 zebrafish
XP_010770599  820 RKIQGQVKDLQRDLEDSCVAQKEVLSSARESERRTKAMEADIAHLHEMLAAAERARKQAETERDELADELTSNSSGKSML 899  black rockcod
Q6URW6       1749 LEEKRQLEGRLSQLEEELEEEQNNSELLKDHYRKLVLQVESLTTELSAERSFSAKAESGRQQLERQIQELRARLGEEDAG 1828 house mouse
XP_005620093 1828 LDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGA 1907 dog
XP_008115388 1768 LDEKRHLEARIGQLEEELDEEQSNMELLNDRYRKLSMQVETLTTELGAERSFSQKTENARQQLERQNKDLRAKLGEMDSS 1847 green anole
NP_001095597 1728 QDEKRRLEARIAQLEEELEEEQGNTEAMSERVRKATQQAEQLSNELATERSAAQKNENARQQLERQNKELRSKLQEMEGA 1807 cattle
XP_012822870 1745 LDEKRALEMRISQLEEELDEEQSNTELINDRYRKLTLQVETITTELSAERSFSQKAENARQQMERQNKELKVKLNEMDST 1824 western clawe...
XP_009297903 1743 SDEKRRLESKIQHLEEELDDEQATTETLNERLRRSVQEVDQLTNELHTERSNAQRMESGWQQMERQNKELRAKLLEMEGQ 1822 zebrafish
XP_011476026 1741 SDEKRRLEAKISQLEEELEEEQANVETLNERLRKSQQLVDQLGAELTAERASSQNREGSRLQLEKQTRDLKAKLQDVESQ 1820 Japanese medaka
XP_009860140 1729 QDDKRRIEARIADMEEENEDLASTVEILDEKNRKLQSQNEQLQNELSSERSSLQKQESAKSHLERQNKELKLKLSEMEQT 1808 vase tunicate
XP_009290473 1793 FDEKRRLETRITQMEEELEEAQSNAELLAERQRKSTLQIETLTVQLSGERTLAQKSESARETLERQNKELKTRLSEMEGA 1872 zebrafish
XP_010770599  900 SDENRRMDAKISQMEEELEEEQANVESLNDRLRKSQQLVDQLGAELAVERSTSQSKETSRQQLERQTRELKAKLQEVEGQ 979  black rockcod
Q6URW6       1829 ARARQKMLIAALESKLAQAEEQLEQESRERILSGKLVRRAEKRLKEVVLQVDEERRVADQVRDQLEKSNLRLKQLKRQLE 1908 house mouse
XP_005620093 1908 VKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLE 1987 dog
XP_008115388 1848 VKSKYKMAIATLESKVAQLEEQLEQESRERILSGKLVRRAEKKLKEVILQVDEERRNADQYKDQVEKGHLRLKQLKRQLE 1927 green anole
NP_001095597 1808 VKSKFKSTIAALEAKIAQLEEQVEQEAREKQATAKALKQKDKKLKEALLQVEDERKMAEQYKEQAEKGNLRVKQLKRQLE 1887 cattle
XP_012822870 1825 MRSKYKITIASLEAKISQLEEQMEQESKERIIANKLVRRAEKRLKEVLLQVEEERRNADQFKEQLEKANIRMKQLKRQLE 1904 western clawe...
XP_009297903 1823 VKSKQRSTVAALESKLQQTEDQLDHESRERQAIAKAMRQKDKKLKELMNQVEDERKQMEQYKDQAEKANLRARQLKMQME 1902 zebrafish
XP_011476026 1821 ARSKLKSSVAALEAKLREAEEQLEVESRERQASAKNLRQKEKKLKDLTAQMEDERKQAQDYKDQMEKSSARMKQLKHQLE 1900 Japanese medaka
XP_009860140 1809 VRTKQKNAIAALEAKILSTEEQLEAEAKERSAANKLLRRSEKKLKETLLLVDDERNHADQYKEQVDKVSSRVKALKRQLD 1888 vase tunicate
XP_009290473 1873 VKGKHRLSVAALEAKIESMEEQVEQERQERAMANKLVRKTEKKLKEVLMQVEDERRHADQYREQLDKSMGRLRQLKRQLE 1952 zebrafish
XP_010770599  980 GRSKLKSSITALEFKLREAEEQLEIESRERQSNAKNLRQKEKKLKDLTIQMEDERKQAQQYKDQAEKGNVRVKQLKHQLE 1059 black rockcod
Q6URW6       1909 EAEEEASRAQAGRRRLQRELEDVTESAESMNREVTTLRNRL 1949 house mouse
XP_005620093 1988 EAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRL 2028 dog
XP_008115388 1928 EAEEEASRANASRRRMQRELEDVTESAESMNREVTSLRNRL 1968 green anole
NP_001095597 1888 EAEEESQRINANRRKLQRELDEATESNEAMGREVTALKSKL 1928 cattle
XP_012822870 1905 EAEEEASRANSNRRRLQRELEDVTESAESMNREVTTLRSRL 1945 western clawed frog
XP_009297903 1903 ESDEESQRATAARRKLQKELNEAIEANDALSREVSSLRSKL 1943 zebrafish
XP_011476026 1901 EAEEEAQRVAAARRKLQRELDEALEANDALSREVSSLRSKL 1941 Japanese medaka
XP_009860140 1889 DAEEEVSRANAAKRKIQRDLDDTTEQNETLHREVSQLRNKL 1929 vase tunicate
XP_009290473 1953 EVEEENSRSNAQRRKLQRELEEMSDSMQSMNRELNTLRSQL 1993 zebrafish
XP_010770599 1060 EAEEEAQRVAAARRKLQRELEEASEANDTMNRDMASLRSKL 1100 black rockcod
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap