2JP3,2MKV


Conserved Protein Domain Family
ATP1G1_PLM_MAT8

?
pfam02038: ATP1G1_PLM_MAT8 (this model, PSSM-Id:280252 is obsolete and has been replaced by 396568)
Click on image for an interactive view with Cn3D
ATP1G1/PLM/MAT8 family
Statistics
?
PSSM-Id: 280252
View PSSM: pfam02038
Aligned: 28 rows
Threshold Bit Score: 53.3845
Threshold Setting Gi: 169404534
Created: 21-Jun-2015
Updated: 5-Aug-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JP3_A         5 DKGSPFYYDWESLQLGGLIFGGLLCIAGIALALSGK-CKcRRNHTPS 50  Norway rat
Q04679        14 GTENPFEYDYETVRKGGLIFAGLAFVVGLLILLSKR-FRcGGSKKHR 59  Norway rat
2MKV_A        12 GDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRR-FRsGGNKKRR 57  human
XP_011950901 110 ENEDPFYYDYETVRNGGLIFAALAFIVGLVIILSKR-FRcGAKKKHR 155 sheep
XP_005611661  12 GDVDPFYYDYETVRNGGLIFAALAFLVGLLILLGKR-LRcGAKKQHR 57  horse
NP_001116266  10 QMQDKFTYDYETVRKGGLIFAAIAFVVGMLIIFSGR-FRcGRKKQLR 55  western clawed frog
XP_002762055 130 HEDDPFFYDEHTLRKRGLLVAAVLFITGIIILTSGK-CR-QLSQLCR 174 white-tufted-ear marmoset
XP_012294244  13 EEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKK-VKcRkadsrs 58  Ma's night monkey
XP_012400443  12 GDEDRFTYDYDTIRNGGLIFAGLAFIVGLIIILGKR-LRcGGKKKRR 57  Tasmanian devil
EHB14009     138 DEDSPFYYDEPTLRKQGLLVAAVLFITGIVILTSKNgIRgKGTKSQR 184 naked mole-rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap