4LHD


Conserved Protein Domain Family
GDC-P

?
pfam02347: GDC-P (this model, PSSM-Id:280502 is obsolete and has been replaced by 396772)
Click on image for an interactive view with Cn3D
Glycine cleavage system P-protein
This family consists of Glycine cleavage system P-proteins EC:1.4.4.2 from bacterial, mammalian and plant sources. The P protein is part of the glycine decarboxylase multienzyme complex EC:2.1.2.10 (GDC) also annotated as glycine cleavage system or glycine synthase. GDC consists of four proteins P, H, L and T. The reaction catalyzed by this protein is:- Glycine + lipoylprotein <=> S-aminomethyldihydrolipoylprotein + CO2
Statistics
?
PSSM-Id: 280502
View PSSM: pfam02347
Aligned: 9 rows
Threshold Bit Score: 648.664
Threshold Setting Gi: 37537758
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4LHD_A   35 DRHLGPGETEQRQMLQTLGFDTLGDLIDQAVPPAIRFPRSLQLPAS------------QSEYGAIAQLKSIAS--KNQV- 99   Synechocystis sp. P...
P23378   65 RRHIGPGDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDP------------VCENEILATLHAISS--KNQI- 129  human
Q21962   32 DRHIGPRRLEQQQMLDFIGYKDLDDLTGTNVPNMIKAEKALELPAP------------LDEYKMLKELEAIAA--QNKI- 96   Caenorhabditis elegans
P33195   16 ERHIGPDAAQQQEMLNAVGAQSLNALTGQIVPKDIQLATPPQVGAP------------ATEYAALAELKAIAS--RNKR- 80   Escherichia coli K-12
P49095   69 RRHLGPSPSDVKKMLKTMGYSDLNAFIEELVPPNILKRRPLKLEAPsk---------gFCEQEMLQHLEKIAN--KNHYk 137  Saccharomyces cerev...
P9WN53    9 DRHIGLDSQAVATMLAVIGVDSLDDLAVKAVPAGILDTLTDTGAAPglds----lppaASEAEALAELRALAD--ANTV- 81   Mycobacterium tuber...
P54376    3 HRYLPATEKDKQEMLATIGVSSIDDLF-ADIPENVKYKKEHQIKKA------------KSETELTRELTKLASknRDTVq 69   Bacillus subtilis s...
O67193    1 MSYIPHSEEETKEILSKLGLESLEDLF-SHIPKEL-FAKDFSFPEP------------KSEEELRRIFER-AC--EDTEl 63   Aquifex aeolicus VF5
Q09785   65 PRHIGPSKTDQQYQLESLGYKDFDSFLKDVIPDSVRTPESQLMAFGsvnpneknppvnYSESEFTTLANNVAN--QNKL- 141  Schizosaccharomyces...
4LHD_A  100 FRSYIGMGYYDTITPPVIQRNILENPGWYTAYTPYQAEIAQGRLEALLNFQTMVMDLTGLEIANASLLDEGTAAAEAMAL 179  Synechocystis sp. P...
P23378  130 WRSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQTMVCDITGLDMANASLLDEGTAAAEALQL 209  human
Q21962   97 YRSYIGMGYYDTIVPAVISRNILQNIGWISQYTPYQAEISQGRLESLLNFQTMIAEMTGLPTTNASLLDEATASAEAVAL 176  Caenorhabditis elegans
P33195   81 FTSYIGMGYTAVQLPPVILRNMLENPGWYTAYTPYQPEVSQGRLEALLNFQQVTLDLTGLDMASASLLDEATAAAEAMAM 160  Escherichia coli K-12
P49095  138 VKNFIGKGYYGTILPPVIQRNLLESPEWYTSYTPYQPEISQGRLEALLNFQTVVSDLTGLPVANASLLDEGTAAGEAMLL 217  Saccharomyces cerev...
P9WN53   82 AVSMIGQGYYDTHTPPVLLRNIIENPAWYTAYTPYQPEISQGRLEALLNFQTLVTDLTGLEIANASMLDEGTAAAEAMTL 161  Mycobacterium tuber...
P54376   70 YASFLGAGVYDHYQPVIVDH-VISRSEFYTAYTPYQPEISQGELQAIFEFQTMICELTGMDIANSSMYDGGTALAEAAML 148  Bacillus subtilis s...
O67193   64 PLYFIGAGAYDRIIPSVIWQ-ILSRGEFLTPYTPYQAEASQGTLQAIFEYQSLICELTGMDVANASMYDGASALAEAVLM 142  Aquifex aeolicus VF5
Q09785  142 IKSFIGMGYYNVKLPAAIQRNVLENPEWYTQYTPYQAEISQGRLESMMNYQTMIADLTGLSISNASLLDEGTAAGEAMVM 221  Schizosaccharomyces...
4LHD_A  180 SYGVSKSKa-nAFFVAQDCHPQTIEVIKTRANPLGIEVIVGDHHTFSFS-----------TSIFGALLQYPATDGAVYD- 246  Synechocystis sp. P...
P23378  210 CYRHNKRR---KFLVDPRCHPQTIAVVQTRAKYTGVLTELKLPCEMDFSg----------KDVSGVLFQYPDTEGKVED- 275  human
Q21962  177 AARTTKRN---KIVVDSFCHPQNLDVIRTRSGPLGIDIEVSDSIEGYAFd----------DKVAAVVVQYPNTEGRIHQ- 242  Caenorhabditis elegans
P33195  161 AKRVSKLKnanRFFVASDVHPQTLDVVRTRAETFGFEVIVDD--AQKVLd---------hQDVFGVLLQQVGTTGEIHD- 228  Escherichia coli K-12
P49095  218 SFNISRKKk-lKYVIDKKLHQQTKSVLHTRAKPFNIEIIEVDCSDIKKAvdv-----lknPDVSGCLVQYPATDGSILPp 291  Saccharomyces cerev...
P9WN53  162 MHRAARGPv-kRVVVDADVFTQTAAVLATRAKPLGIEIVTADLRAGLPD-----------GEFFGVIAQLPGASGRITD- 228  Mycobacterium tuber...
P54376  149 ASGHTKKK---KIVVSKTVHPESREVLKTYAKGQYIDVVEVP-AADGVTdldal-rqtvcENTAAVIVQYPNFFGRIEP- 222  Bacillus subtilis s...
O67193  143 -ARAIKGKg-dTVVLSKALNPLYRRTVKTYLRGYEDKIVEVPYTEEGTTdlnnleevlkeSEVHALAVQYPNFFGFVEP- 219  Aquifex aeolicus VF5
Q09785  222 LMANDKKKr-kTFLVDKNIYPNTLSVLRTRASGFGIKIELDNITPELITks--------aKHVFGIFVQYPAADGSIFD- 291  Schizosaccharomyces...
4LHD_A  247 --YRSFIDKAHQHQALVTLAADPLSLTLLTPPGELGADIAVGSTQRFGIPLGYGGPHAAYFATKAE-----YQRKMPGRI 319  Synechocystis sp. P...
P23378  276 --FTELVERAHQSGSLACCATDLLALCILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRES-----LVRMMPGRM 348  human
Q21962  243 --FDELIESAHKNKSLVIMVCDLLSLTILRSPGDLGADIAVGSAQRFGVPLGYGGPHAGFMAVAKHdaknaLGRNIPGRI 320  Caenorhabditis elegans
P33195  229 --YTALISELKSRKIVVSVAADIMALVLLTAPGKQGADIVFGSAQRFGVPMGYGGPHAAFFAAKDE-----YKRSMPGRI 301  Escherichia coli K-12
P49095  292 dsMKQLSDALHSHKSLLSVASDLMALTLLKPPAHYGADIVLGSSQRFGVPMGYGGPHAAFFAVIDK-----LNRKIPGRI 366  Saccharomyces cerev...
P9WN53  229 --WSALVQQAHDRGALVAVGADLLALTLIAPPGEIGADVAFGTTQRFGVPMGFGGPHAGYLAVHAK-----HARQLPGRL 301  Mycobacterium tuber...
P54376  223 --LKDIEPIAHQGKSMFIVSANPLALGLLTPPGKFQSDIVVGDAQPFGIPSAYGGPHCGFFAVTKK-----LMRKVPGRL 295  Bacillus subtilis s...
O67193  220 --LKEIGELCKKYEVPFVVFVDPIALSILKPPAEFGADIVVGEGQQMGIPLSFGGPYVGFFATKk-----eHVRKMPGRL 292  Aquifex aeolicus VF5
Q09785  292 --YGHLAATARSFNMHVVAATDLLALTILKSPGEWGADVAVGSTQRFGLPMGYGGPHAGFFACSEE-----FKRKIPGRL 364  Schizosaccharomyces...
4LHD_A  320 VGVSKDAHGNPALRLALQTREQHIRRDKATSNICTAQVLLAVMASMYGVYHGSTGLKNIALRIHQLTVLLAIGLKRl--N 397  Synechocystis sp. P...
P23378  349 VGVTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVHNATLILSEGLKRa--G 426  human
Q21962  321 IGVTKDANGNRALRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPQRLTEIARGVHKSTAYLAYHLRNa--G 398  Caenorhabditis elegans
P33195  302 IGVSKDAAGNTALRMAMQTREQHIRREKANSNICTSQVLLANIASLYAVYHGPVGLKRIANRIHRLTDILAAGLQQk--G 379  Escherichia coli K-12
P49095  367 VGISKDRLGKTALRLALQTREQHIKRDKATSNICTAQALLANVASSYCVYHGPKGLQNISRRIFSLTSILANAIENdscP 446  Saccharomyces cerev...
P9WN53  302 VGVSVDSDGTPAYRLALQTREQHIRRDKATSNICTAQVLLAVLAAMYASYHGAGGLTAIARRVHAHAEAIAGAL-----G 376  Mycobacterium tuber...
P54376  296 VGQTEDENGKRGFVLTLQAREQHIRRDKATSNICSNQALNALAASVAMTALGKNGVKDIARQNLLKANYAKQEAKKaglT 375  Bacillus subtilis s...
O67193  293 VGMGEDIEGKRAFTLVLQTREQHIRRERATSNICTNQNLMALANLLYMVLLGKEGMKKVAVQSLSKALYFKKELMKkgfE 372  Aquifex aeolicus VF5
Q09785  365 IGLSKDRLENPAYRLALQTREQHIRREKATSNICTAQALLANMSAFYAIYHGPNGLQEIANRIYASTSFLKSALESs-gY 443  Schizosaccharomyces...
4LHD_A  398 YSLNNDYFFDTLRVGVGe-QSAPA-ILKAAEGRG--INLRPLVPG-EVGISLDETVTVQDLLDLWQVF 460  Synechocystis sp. PCC 6803 subs...
P23378  427 HQLQHDLFFDTLKIQCG--CSVKE-VLGRAAQRQ--INFRLFEDG-TLGISLDETVNEKDLDDLLWIF 488  human
Q21962  399 HEIVHKDYFDTLKIRLKdkAALEE-TKKRAEEMK--MNFRYYEDG-DIGVSLDETVKSEDLMDIIYTL 462  Caenorhabditis elegans
P33195  380 LKLRHAHYFDTLCVEVAd-KAG---VLTRAEAAE--INLRSDILN-AVGITLDETTTRENVMQLFNVL 440  Escherichia coli K-12
P49095  447 HELINKTWFDTLTIKLGngISSEQ-LLDKALKEFn-INLFAVDTT-TISLALDETTTKADVENLLKVF 511  Saccharomyces cerevisiae S288c
P9WN53  377 DALVHDKYFDTVLARVPg-RAD-E-VLARAKANG--INLWRVDAD-HVSVACDEATTDTHVAVVLDAF 438  Mycobacterium tuberculosis H37Rv
P54376  376 VMFDGPMFNEFVIKLDEpvRAVNKrLLAKGMIGGydLGLTYPELDcHMLIAVTELRTKEEIDALIQEL 443  Bacillus subtilis subsp. subtil...
O67193  373 EVFTGKHLWEFPLR-HEslKAIYRkLLKEKIVLGlpLDRFYEDLKnTTLIAVTEKRTKEEIDSVLALL 439  Aquifex aeolicus VF5
Q09785  444 KIVNKSHFFDTLTIEVE---SADK-VLAKALDHG--YNLRKVDDS-HVGLSLDETVCDKDIQALFSIF 504  Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap