Conserved Protein Domain Family
PMT

?
pfam02366: PMT (this model, PSSM-Id:280519 is obsolete and has been replaced by 396786)
Dolichyl-phosphate-mannose-protein mannosyltransferase
This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
Statistics
?
PSSM-Id: 280519
View PSSM: pfam02366
Aligned: 19 rows
Threshold Bit Score: 138.983
Threshold Setting Gi: 14286030
Created: 19-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P73065   8 KSWGVPLLLAMVWLGSNGLDRLWLGMDQTVPAWDQSNHLSYGLEYlqALRSPEFLSGEWWrsfwmLSPKYPPLTYIVNAP 87  Synechocystis sp. PCC...
P33775  54 ACLAVFTAVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTYFMDVH--PPLAKMLYAGVAS-----LGGFQGDFDFENIG- 125 Saccharomyces cerevis...
P52867  50 GCLLIFTAIVRLHNISLPNSVVFGENEVGTFVSQYVNNIFFTDVH--PPLVAMLYATVSS-----VFGYKGLFNYGNIG- 121 Saccharomyces cerevis...
P46971  57 TIVTLLAFAARFYKIWYPKEVVFDEVHFGKFASYYLERSYFFDVH--PPFAKMMIAFIGW-----LCGYDGSFKFDEIGY 129 Saccharomyces cerevis...
O42933  63 VLITVLSFITRFWNLNLPGEVVFDEVHFGKFASYYLQGKYFFDLH--PPFAKLLLALVAK-----LAGYDGHYLFDNIGD 135 Schizosaccharomyces p...
P73712   7 NSSRRLISVIIYLTIFIRVLTLGLYAVADRTEARYAEIGRKMAET--GDWITPQIDYGVP-----FWGKPPLSTWLTAAS 79  Synechocystis sp. PCC...
O52327   3 SIRYYLAFAAFIALYYVIPVNSRLLWQPDET--RYAEISREMLASg-DWIVPHFL--GLR-----YFEKPIAGYWINSLG 72  Salmonella enterica s...
P76473   3 SVRYLIGLFAFIACYYLLPISTRLLWQPDET--RYAEISREMLASg-DWIVPHLL--GLR-----YFEKPIAGYWINSIG 72  Escherichia coli K-12
P73015  18 VAIFLFSLVIRFWNLGQFNQLVFDEVYYAKFASDYWLGNDFFPSH--PPLSHYLIALAMG-----LGQVFPVNPEQVN-- 88  Synechocystis sp. PCC...
Q9VTK2 178 WTLFLLAFGTRFYKLATPPHIVFDELHYGKYISMYMRNIFFFDQH--PPLGKQLIAGLVS-----LAGYDGNYTFTRIGE 250 fruit fly
P73065  88 FQGLG-GPGSDLALLSNWLWSGILILSVYGLGKKLFSREIGLWAVAIMVLIPRLIHSRLIVLLDSPLLAFTLLSFTCLTY 166 Synechocystis sp. PCC...
P33775 126 DSFPStTPYVLMRFFSASLGALTVILMYMTLRYSGVRMWVALMSAICFAVENSYVTISRYILLDAPLMFFIAAAVYSFKK 205 Saccharomyces cerevis...
P52867 122 TEYTAnVPYVAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAAICAVCFAIENSFVTLSRFTLIEGPFVFFMACAVYFFRR 201 Saccharomyces cerevis...
P46971 130 SYETHpAPYIAYRSFNAILGTLTVPIMFNTLKELNFRAITCAFASLLVAIDTAHVTETRLILLDAILIISIAATMYCYVR 209 Saccharomyces cerevis...
O42933 136 NYKDNgVPYVTIRAWPALLSSLVPPVVFLIMKESGYDLLACIVSSSLVLFDNAHVTEGRLILLDATLLFSMVCAIYCYVR 215 Schizosaccharomyces p...
P73712  80 FKVFS-VNEFAARLSSFIPILLASYLVYLLAKNKGI--NYALVSTMILITTLGFFVSSGAVMTDPALVLGTTLSMVGFWQ 156 Synechocystis sp. PCC...
O52327  73 QWLFG-ATNFGVRAGAILTTLLAAALVAWLTFRLWRDKRTALLASVIFLSLFAVYSIGTYAVLDPMIALWLTAGMCCFWQ 151 Salmonella enterica s...
P76473  73 QWLFG-ANNFGVRAGVIFATLLTAALVTWFTLRLWRDKRLALLATVIYLSLFIVYAIGTYAVLDPFIAFWLVAGMCSFWL 151 Escherichia coli K-12
P73015  89 DLTGAvRSTWSYRWLNALTGATIPLLLGAIAYLLTQRRLVTLLTMGLVALDGLFLVESRYALNNIYLVFFGLLGQALVLW 168 Synechocystis sp. PCC...
Q9VTK2 251 PYSPE-MPIFWFRFLPAMCGSLLAPAVYNLLLEAKLSRWSSALGGLLVVLDNSLLTQSRFVLMESMLLLATTVGIACLLR 329 fruit fly
P73065 167 WK----EAEGRRSQWLWAIAAGVGLGLGLLSKqSIIFYLFFPLVGLGLWSIWTKQWqrlaqLLVGLLASIplwypwyrtn 242 Synechocystis sp. PCC...
P33775 206 YEm---YPANSLNAYKSLLATGIALGMASSSK-WVGLFTVTWVGLLCIWRLWFMIG-----DLTKSSKSI---------- 266 Saccharomyces cerevis...
P52867 202 SEl---YLPNSCKANKSLLAASIALGFAVSSK-WAGLFTIAWAGIIVLWRVWFMIG-----DLSRPIGSS---------- 262 Saccharomyces cerevis...
P46971 210 FYkcqlRQPFTWSWYIWLHATGLSLSFVISTK-YVGVMTYSAIGFAAVVNLWQLLD-----IKAGLSLRQf--------- 274 Saccharomyces cerevis...
O42933 216 FFkl-rHTPFSRPWWAWLFFTGFFLSCTISTK-YVGFFTFLSIGLSVCLELWYLWD-----IKTGLTVERf--------- 279 Schizosaccharomyces p...
P73712 157 AYr----G-ESNAGRLWGYLFFVGLAIGLLAK-GPIG-VVLVFLPLFIWIIWQRNLp----RVWRQLP------------ 213 Synechocystis sp. PCC...
O52327 152 GM----QATTRMGKIGMFLLLGATCGLGVLTK-GFLALAV-PVVSVLPWVIVQKRw-----KDFLLYG------------ 208 Salmonella enterica s...
P76473 152 AM----QAQTWKGKSAGFLLLGITCGMGVMTK-GFLALAV-PVLSVLPWVATQKRw-----KDLFIYG------------ 208 Escherichia coli K-12
P73015 169 H--------LRQEKLWQLILGGISLACAGSVK-WNGFAFLLGVYLLWAIAWVKPFF-----NQGWTKG------------ 222 Synechocystis sp. PCC...
Q9VTK2 330 FQrs---rlGSLEWFFTGTAAAVCLGAAGTVK-YVGFLALGLAFYLLCRHLWQLLY------DAGLTDRQl--------- 390 fruit fly
P73065 243 WIYLFSTAQNSNAIPATLEGDPpvNTLAAWTYY 275 Synechocystis sp. PCC 6803
P33775 267 FKVAFAKLAFLLGVPFALYLVF--FYIHFQSLT 297 Saccharomyces cerevisiae S288C
P52867 263 IKYMAFQFTCLLAIPAFIYFLI--FSVHIKTLN 293 Saccharomyces cerevisiae S288C
P46971 275 MRHFSKRLNGLVLIPFVIYLFW--FWVHFTVLN 305 Saccharomyces cerevisiae S288C
O42933 280 FQHFLARFFCLIFFPFLFFLFW--FYMHFNILT 310 Schizosaccharomyces pombe 972h-
P73712 214 -WIQGILLTALIAVPWYLLAEA--KTPGFLDYF 243 Synechocystis sp. PCC 6803
O52327 209 --WLAVLSCFVVVLPWAIAIAR--READFWHYF 237 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
P76473 209 --WLAVISCVLTVLPWGLAIAQ--REPNFWHYF 237 Escherichia coli K-12
P73015 223 ----ERQANSLQLLDRDGENNQ--GFLSRWLII 249 Synechocystis sp. PCC 6803
Q9VTK2 391 WMHAISRLLIFVGIPLAVYLGV--FYIHFKTLH 421 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap