Conserved Protein Domain Family
Na_Pi_cotrans

?
pfam02690: Na_Pi_cotrans (this model, PSSM-Id:280798 is obsolete and has been replaced by 397008)
Na+/Pi-cotransporter
This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.
Statistics
?
PSSM-Id: 280798
View PSSM: pfam02690
Aligned: 553 rows
Threshold Bit Score: 52.7775
Threshold Setting Gi: 512973433
Created: 21-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2RHH2        15 FFLYGMNLISTGLQKAAARQVQQLLGTVTRNRFYGMLAGLVVTIFLQTSAVTTVLLVGFVSAGLMSLGQALGVILGAAIG 94  Moorella thermo...
Q5WHF2        15 LFLFGMFILRAGLLQIGVEKVQTLLLKATDSPWKGLIAGTLITALFQSSSVVMVLLVGLVAAGIVSFRQTIGVILGTNIG 94  Bacillus clausi...
Q9KD66        15 LFLFGMAVMRAGLLTMNAEKARVGILRFVDNPLKGFFVGLLLTILLQSSSAVMIVTIGFVAAGYVTFRQSIGIILGTNVG 94  Bacillus halodu...
WP_012958118  15 LFLFGMIIMRAGLLPLGGELFQRNVHRFTDKAWKGLLIGTVATAMLQSSSAVLVMTVGLVAANLLTFRQSIGIILGANIG 94  Bacillus pseudo...
WP_014097975  13 tFLFGIHRLRTGLFALSGGHAGNMLKKLAGRPLSAMLFGMVLTALLQSSSAVMVITVGLVSAGMLTFSQSIGIILGTNIG 92  Bacillus coagulans
WP_013075268  13 gFLGGMWTLRHGLEPLAAGHLPAILNRLVKTPLRGLITGTLVTALLQSSGAVTVITIGLVAAGTLAFPDSIGIILGANIG 92  Kyrpidia tusciae
WP_015595025  13 aFIMGMTVLRAGLFQLSGDKLKKLLEQVTSNPFKALITSVLVTATLHSSAAVMVITIGLISAGMLTFPKSIGIILGTNIG 92  Bacillus sp. 1N...
WP_009791388  13 FFIYGMALLRSGLYGLSGDSFKRKIAAYTHFPWQGMLAGMLITAVLQSSSAVMVLTIGLISARILTFPQSIGIILGTNIG 92  Bacillus
WP_013488194  14 LFLFGMTVMRHGLMQLQQNKMKTWIYTFVDHPAKGFLVGILVTAILQSSSAVMIITVGLVAAKYIPFKHSIGIILGTNIG 93  Bacillus cellul...
WP_047072548  15 FFLFGMYAMRSGFQNLAGKKMEEWMGRFTRTPLHSFWIGLFATFVLQSSSAVTVLTIGLTNAGIIQFTQTVGIILGTNLG 94  Brevibacillus f...
Q2RHH2        95 STLTAQLIAFRLSDYSLWAVVAGLIpyLAaRrlRWRYLGQAILGFGLIFYGAALMGT 151 Moorella thermoacetica ATCC 39073
Q5WHF2        95 SCFTLELVAFQLSDLAVPLLLFGLVllMFkSa-ASYTAGCVSFGIGCIFLAMTGLEs 150 Bacillus clausii KSM-K16
Q9KD66        95 TCFTVELIALDLHSLIVPLLLIGLIglAIpHl-ITYCLGCVSFGLACIFISMNGLEn 150 Bacillus halodurans
WP_012958118  95 TTITTEILVLDLSHFIIPLLLTGLValFIpKk-KAFSIGCLTFGLACIFIAMDGLES 150 Bacillus pseudofirmus
WP_014097975  93 TTFTLELLTFDFSSLSLPFLGAGAVfyFFgKg-RVKSAGMILFGLSLVFGAMrgfeq 148 Bacillus coagulans
WP_013075268  93 TCVTTQIIALQLDALVLPCLVAGVFltLTsRr-LWHHIGITLIGFGMIFMALKLMSl 148 Kyrpidia tusciae
WP_015595025  93 TTFTTEIITFDFNQILIPMAIIGAIfmLFkDl-KIKSTGSILFGMSAVFIAIRGfef 148 Bacillus sp. 1NLA3E
WP_009791388  93 TTFTTEFITFNIESLIIPLAAAGSCliLFgRk-ALKHIGMGILGISIVLSSMKGfef 148 Bacillus
WP_013488194  94 TVVTLEVLAIDLSWLIFPLLIIGIFflLTkNy-IVFSIGCFLFGFSSIIVAMDGFQs 149 Bacillus cellulosilyticus
WP_047072548  95 TTVTTELVALKLESFAIPMLLIGVAlwLMpRr-NIRCIGLVVAGFGLIFLGIDTLKv 150 Brevibacillus formosus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap