Conserved Protein Domain Family
OATP

?
pfam03137: OATP (this model, PSSM-Id:281175 is obsolete and has been replaced by 397311)
Organic Anion Transporter Polypeptide (OATP) family
This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described as belonging to the SLC21 family of transporters.
Statistics
?
PSSM-Id: 281175
View PSSM: pfam03137
Aligned: 251 rows
Threshold Bit Score: 264.812
Threshold Setting Gi: 459186080
Created: 11-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q71MB6        102 GFLLHYCLLALTQgIVVNGLVNISISTIEKRYEMKSSLTG-------LISSSYDISFCVLSLFVSFFGERGHKPRWLAFA 174  Norway rat
EFZ17735       50 LYVGLICWIGVVQ-AASYTYFHVTGSTIARRFQIDLDVMGrtysftdWILVVAELTPIVLGLVVAYWGDRIHRTSWIGAL 128  red fire ant
XP_786158      60 VYVTMTCIANVVYiSSIGGYVSASLSTIEQRFQLKSSQSG-------AITIINDVAGMLAILFVTHFGHSRHRPRIAGTA 132  purple sea ur...
XP_003136931   26 CFLVTMLFVIAIQ-GTYLAYVVGILTNLERRFGISSKKSG-------ALLSFYDVGHTISVMLIGFLASDKHLPRITAIG 97   eye worm
CDP94209       26 CFLVTMLFVIAVQ-GTYLAYVVGILTNLERRFGISSKKSG-------SLLSFYDIGHTVSVVLIGFLANDKHLPRITATG 97   Brugia malayi
ERG81202       27 IFLVVMLAVIGVQ-GTYLGYTVGILTNLERRFGISSRKSG-------TLLSIYDIGHTVAVILVGFMANGRNLPRITAIG 98   pig roundworm
KKA71215       22 VFIGLMLLVVAIQ-GCYLGYVVGMLTTLEKRFGISSSPSG-------ALLSVYDVGHTLAILAVGYFGEKAHQPRITGIG 93   Pristionchus ...
NP_509659      18 IFVLLMVLVIAVQ-GTYLGYVVGMLTTLEKRFGFSSEKSG-------WLLSLYDIGHTMAILLIGYIGSHYHLPRITGIG 89   Caenorhabditi...
KKA73383       52 GFLTLFVIVYLME-AMGGMYIVSAIQNIEKQFRLPSKLSG-------ILVSASDIGYIPTVIFIAYFGARGNRARWIGAG 123  Pristionchus ...
XP_009019373   33 TFIVLYFIFSFSH-GVQGTYTSTILATLENNFNLPSSLSS-------IIIIVATLGYMSSAITVSFILTSKHHVRLFAVC 104  Helobdella ro...
Q71MB6        175 SFMIGLGALVFSLPHFFSgryelgtifedtcltrn--------------------------------------------- 209  Norway rat
EFZ17735      129 TLLQSVSYFILIIPHLTH-------------------------------------------------------------- 146  red fire ant
XP_786158     133 FALSGLGTILCALPHFFFdppvammqkmsglggsngttstgggdwaiqdmc----------------------------- 183  purple sea ur...
XP_003136931   98 VLLSAVSMFILALPMVLFeakssteaslsyehdyilrnicdp-------------------------------------- 139  eye worm
CDP94209       98 VLLSAVSMFVLALPMLLFgaessdeaslsheheyilrnicdp-------------------------------------- 139  Brugia malayi
ERG81202       99 VVLSALSMFFLALPAAIFgtvsidqdsltehrqeyilenicdp------------------------------------- 141  pig roundworm
KKA71215       94 IVLSSLSMFILALPALCFgtvpddelhvdkykmqyiedskcd-------------------------------------- 135  Pristionchus ...
NP_509659      90 VILSSLSMFMLALPVLFYgtadytqeqlmqkkeaysvemscdtn------------------------------------ 133  Caenorhabditi...
KKA73383      124 TLGMAVAYLLIASPNFLFptpplargtfgyvkdslmpsnellapnaslalllhyplisdrftpaqignlskfpvaaeinh 203  Pristionchus ...
XP_009019373  105 MLVTGFCGLLYMLTHFIFkdssnineiaattdlekpdrnyvsavcnas-------------------------------- 152  Helobdella ro...
Q71MB6            --------------------------------------------------------------------------------      Norway rat
EFZ17735          --------------------------------------------------------------------------------      red fire ant
XP_786158     184 --------------------------------------------------------------------ypedslgpsqpp 195  purple sea ur...
XP_003136931  140 ----------------------------------------------------------------------------srvt 143  eye worm
CDP94209      140 ----------------------------------------------------------------------------arvi 143  Brugia malayi
ERG81202      142 ----------------------------------------------------------------------------yrrs 145  pig roundworm
KKA71215      136 ----------------------------------------------------------------------------ssrf 139  Pristionchus ...
NP_509659     134 ---------------------------------------------------------------------------grrei 138  Caenorhabditi...
KKA73383      204 qmvinnksspymvdyglmheavfeahkllnstpdaadaskfrsllatyvarrkdvdglqgmraasnapfsycsalvnsmq 283  Pristionchus ...
XP_009019373  153 ----------------------------------------------------------------------rninessesl 162  Helobdella ro...
Q71MB6        210 ---strcasstsllsnyfyvFV---------------------------LGQLL--------------------LGTGGT 239  Norway rat
EFZ17735      147 --------------------SVrvieetqnvtqmslyaddspdlcsrgaLSRIItednetcystiviislvliiSGIANI 206  red fire ant
XP_786158     196 eqcdasekstsgsliwqvgwIL---------------------------FGQIL--------------------CGFGSC 228  purple sea ur...
XP_003136931  144 vdldhncefqedehflafciLI---------------------------IGQIL--------------------AGIAAA 176  eye worm
CDP94209      144 nsaekncelqekehfwafciLI---------------------------IGQIL--------------------AGIAAA 176  Brugia malayi
ERG81202      146 ltadehcerqrkeeiaafhiLA---------------------------TGQFL--------------------AGVAAA 178  pig roundworm
KKA71215      140 itdngdcakeksehtwalvlLM---------------------------FGQLL--------------------AGIFSA 172  Pristionchus ...
NP_509659     139 ssqgedcwrehhehtnafiiLA---------------------------FGQLF--------------------AGIFAA 171  Caenorhabditi...
KKA73383      284 akirelkcmngedshgpfivFC---------------------------MALLL--------------------LGIGRT 316  Pristionchus ...
XP_009019373  163 ctgsnnnkrdigpnyvalgmFV---------------------------ISEVF--------------------HGAAGA 195  Helobdella ro...
Q71MB6        240 PLYTLGTAFIDDSVPTHKSS-LYIGIGYSMSILGPAIGYVLGGQLLTmyidvamgqssdLTE-----DDPRWLGAWWIGF 313  Norway rat
EFZ17735      207 AYYALGISYLDDNTRKKNVT-SYISVIIALKIIGVLLGYFVGWGCLRidaen---fsviTSY-----QD--QMGAWWLGF 275  red fire ant
XP_786158     229 A-QPLCITYLDDNVKNKRNTtIFVGIIFSTFALGPTTGFMLATTCLSrptff---ydpsVPPpavpqGHPYYIGAWWLGF 304  purple sea ur...
XP_003136931  177 PFNTVAYVYVDNNLADKTKSpFYLSLLSSMYAFAPAFGFALSAFVTRlntt------mvdVPssatiNSDEWIGAWWLGF 250  eye worm
CDP94209      177 PFNTVAYVYVDNNLEDKTKSpFYLSLLSSMYAFAPAFGFALSAVITRlyst------ifdVPsnvsvNNDEWIGAWWLGF 250  Brugia malayi
ERG81202      179 PFNTIAYVYIDDNLENKALSpFFLGLLSGMYAFGPAFGFGLSAGLTRvyss------itgAPpnlniNSEEWVGAWWLGF 252  pig roundworm
KKA71215      173 PFNTLAYVFIDNNIEDRRRSpFILGLLTSMYAFGPAFGFALSAVFNQfyat------lgeAPtglvpSDEEWVGAWWLGF 246  Pristionchus ...
NP_509659     172 PFNTIAYVYIDSNVKQKRESpFLLGLLTSMYAFGPALGFMLSSILNGvyts------lgdAPdhigtHDEHWIGAWWLGF 245  Caenorhabditi...
KKA73383      317 LPWSLGVPLIDDNVSKKSMP-TYFGAISFIRILGPISGFLVASVVNKfyf-------dfnPPeglrpEDQSWIGAWWLGF 388  Pristionchus ...
XP_009019373  196 CLWTVGLSFLDDNMPSNVAP-KLIGIMYSVRFLSPVISSALGSVFLSlht--------slTKtsltpSHPKWIGAWWLGF 266  Helobdella ro...
Q71MB6        314 LLA-WLFAWSLIMPFSCFPKH----L---------PGTAKIQAGKtSq--------tHQNN------Stsfqhmde---- 361  Norway rat
EFZ17735      276 PIF-SILLVIPGLLLSWFPRR----L---------PSEVVEQAAAsLl--------nGTAT------Snrsphrtt---- 323  red fire ant
XP_786158     305 LIN-GGMLLIVSIPFFFFPKTmrrqV---------RNEVPDDAADrSse------vkSIEQngkgegDddsptmystkke 368  purple sea ur...
XP_003136931  251 IIF-GLLYLTGAIPLLCFPKK----Llqyd--snsFEMQQLRKGCqHdhddhqiivsENDErpe-eiFceqlk------- 315  eye worm
CDP94209      251 VIF-GLFYLAAIVPLLFFPKN----Llkhd--sssFEMQQLRNKCsHdhddhqlslfGYDErlk-etFcgqlk------- 315  Brugia malayi
ERG81202      253 LIC-GVLYLFCSVPLFFFPKS----LihpdedlnnAEMHQLRHEQlHlhthhdhelaTNEEttqrpsFldqlk------- 320  pig roundworm
KKA71215      247 IVC-GVLYLLTAAPFFFFPAS----Yq-------eEHGVELQSLRqGkenkpslppfEEEEttgcarLkes--------- 305  Pristionchus ...
NP_509659     246 LVC-GSAYLILAVPFFFFPRT----------------YKHPDSFHlMlehsrpqvspEDRLtfkeniTlf---------- 298  Caenorhabditi...
KKA73383      389 IIIgVLTIVPSI--------A----L---------C---LFPTANvNvt-------sADGKqrkinfNdkhrdmensek- 436  Pristionchus ...
XP_009019373  267 VIC-FLINTIISLPTFFLPQT----F---------ENSKKLEHHTkGseqnlddkfsSAKTaskvyhGkn---------- 322  Helobdella ro...
Q71MB6        362 ------nfgksikDFPTAVKNLMRNTVFIC----LVLSTTSEALVTTGFATFLPKFIENQFGLTSSFAATLGG------- 424  Norway rat
EFZ17735      324 ------nqkvgspAFLPSLCRLITNKILMC----NILATVFCAMALLNFIAHEDIFLESRFQAPRPT-GMLRGfsdplys 392  red fire ant
XP_786158     369 irpnqlglssfisDFFQTLKRIITNVTAMS----VFLATASEISGHVGWFIFGPKFMYTQFRLPPAKSSMLFG------- 437  purple sea ur...
XP_003136931  316 ---------atvsEFP----RLIKNPVFTS----MIIGWMFGSYLTSGYSTYLPKYIETQFGRSASAADTYAG------- 371  eye worm
CDP94209      316 ---------aaviEFP----GLVKNRVFIS----MIIGWMFGSYLTSGYCTYLPKYIETQFGHSASVADTYAG------- 371  Brugia malayi
ERG81202      321 ---------saveDLPYMAWDLLKNPVYTS----MVIGWMFGSYLVGGFSTYLPKYIETQYGRSASAADMYAG------- 380  pig roundworm
KKA71215      306 -----------msDFPSVLADLLRNPVYVT----MVLGWMFGSYLIAGYGTYLPKYIETQFGRSASMADLYAG------- 363  Pristionchus ...
NP_509659     299 -----------lrEFPMVLKKLITNKVYIT----MVIAWMFGSYLIGGYQTYLPKFIETQYGRSASMADIYSG------- 356  Caenorhabditi...
KKA73383      437 ---glserikdfgS---TYRSVITSKIYVYsatgRILD----IMAFKGYIVFLPKYLENHFGIARYLVHRYMA------- 499  Pristionchus ...
XP_009019373  323 -----------leNFGLALGRLLRNPIYML----TTLGICFDCFII-PFYNYLPKYVEVHFKLTAWMASII--------- 377  Helobdella ro...
Q71MB6        425 --AVLIP-GAALG--Q--ILGGVLVSKFKMKC--KN--TMKFALCTSGVALMLSFVFIYAKCENGPFA-GvseSYNG--- 489  Norway rat
EFZ17735      393 rlAINIMrPVVIGliV--IISGLVLSKAKPRS--RY--IIAYSFVIVLLTLAIIIALIFATCDKPPIV-GidkD------ 459  red fire ant
XP_786158     438 --MMMLP-GPIFG--N--LFASLIVRKFKLDS--KG--CAKMILMIYTVLVILSPLLYWLGCDNPSNA-GlvvPYHTdps 505  purple sea ur...
XP_003136931  372 --IVSIG-SIAVS--T--ALGGYLLTNFNPSP--RK--ALLFLIATWSIIVITYLIGAIVGCDEPQVK-Qlligain--- 436  eye worm
CDP94209      372 --IVSIG-SIAVS--T--ALGGYLLTKFNPSP--RK--ALLFLIATWFIIVITYLVGAIVGCNAPQVK-Elliaain--- 436  Brugia malayi
ERG81202      381 --IISIG-SVAVS--T--ALGGYILTKFNLSP--RN--AILCLIGSWLVILASYFLGMTVGCDEPAIK-Elivhtltt-- 446  pig roundworm
KKA71215      364 --IISIG-AVASA--T--AIGGYVLSRSNVGP--RA--AILLLLGSWIIVVISYLSGIIFSCQQPSIH-Gleyvehvd-- 429  Pristionchus ...
NP_509659     357 --IISVG-AIAVS--T--ALGGWILSRYNIAP--RS--SIICLIGSWIVILVSYIIGMNLGCSQPKVE-Gltyvdyasrw 424  Caenorhabditi...
KKA73383      500 --IFGVF-GFALG--S--GCGGLLTRKFKLNG--KR--VALYVFIVSSLNILMYFSKIFIACDSSLAEiGrqhega---- 564  Pristionchus ...
XP_009019373  378 --AVMVP-SIAGG--IfsSVGGFVIGKFKPSPdfRVtkNMAFSCVISFGSVLVLTAILFLQCPNVNSPsGysemtk---- 448  Helobdella ro...
Q71MB6        490 Tgemg-------------nltAPC-NANCNCL-RS-YYYPLCGSDG-VQYFSPCFAGC-LNSVsn---rKPKAYYNCSCI 548  Norway rat
EFZ17735      460 --------------------------LDCRCS-KDaDFRPICDTSGkFTYYSPCYAGCsTIIYv----dDVKIYSDCTCV 508  red fire ant
XP_786158     506 GvsplpfatlptnveysddltASC-NVECNCS--P-DFVPVCGSDG-LTYATACHAGCrDVVMvdvdgvNSTIFVECSCI 580  purple sea ur...
XP_003136931  437 --------------eekfngnLEC-SFECQCSqVD-LFNPV-NYHT-TNYFSPCHAGCrDYNS------HLQKWDLCLCA 492  eye worm
CDP94209      437 --------------qekfidkLEC-SFECQCTqVD-FFNP---------------------------------WDLCLCA 467  Brugia malayi
ERG81202      447 --------------ryefrdvSEC-NFECHCGsVY-HFNAV-HYNT-TNYFSPCHAGCrEFNA------LLEKWDVCSCA 502  pig roundworm
KKA71215      430 --------------sytfnsvQSC-SSHCQCDsGT-FYiikyiinlfq-------------------------------- 461  Pristionchus ...
NP_509659     425 ------------hfyhhrereQEClEY-CNCEtVL-KFDGV-SYNG-QNFYSPCHAGCtEYDI------YSNTWSNCQCA 482  Caenorhabditi...
KKA73383      565 ----------------tynltHSC-NVDCGCE-GA-KLYPVCDRSG-KPFFSPCHAGC-REAShhg-ehTSIEFSSCACA 622  Pristionchus ...
XP_009019373  449 ----------------svsltQTC-NMNCSCL-SD-SFDPVCGDDN-MWYASPCHAGCsSYATn-----GSMMYSDCSCI 503  Helobdella ro...
Q71MB6        549 ERKVditstaxsPDFE----ARAGK------CKT-QCsN-LPIFLGIFFITVIFTFMAGTPITVSILRCVNHRQRSLALG 616  Norway rat
EFZ17735      509 VFMT----------GWgndqAKDGP------CDSiRCqAgWMLFEFGTLVAYSLIASTFVGDLLINIRSVFKQDKAISIG 572  red fire ant
XP_786158     581 PEMKsnstvivgIEELssgfAYPAE------CPW-SC-DkLYYFLGMMLFGSLLGSTVYNPAFMLQFRSHREEDRSTALG 652  purple sea ur...
XP_003136931  493 D----------------------NGpvetglFVD-EC-NaVFIYVAITFTGLFFGNLFFMTTMMVVLRSVYDDEKVLALS 548  eye worm
CDP94209      468 D----------------------NGpvetglYTD-EC-NaIFIYIASMFMGLFLGNLFFMTTMMIVLRSVYDDEKVLALS 523  Brugia malayi
ERG81202      503 N----------------------NGpvenglYLK-EC-NqIFAYITLMFVGLFFGNLFFMTTMMVILRAVHDCEKVMALS 558  pig roundworm
KKA71215          --------------------------------------------------------------------------------      Pristionchus ...
NP_509659     483 Y----------------------GNmvdkglVHP-DC-GiFFAYLAVMLIGLFIGNLFFMVTMMIVLRSVFDEEKVIALS 538  Caenorhabditi...
KKA73383      623 A--------------D-------GRvak-ewCVQ-SCkPaTVAFFSTVLIGSFIGGLGIVPGLLILIRSVPPATRSAALG 679  Pristionchus ...
XP_009019373  504 N--------------SvqqtAGRGY------CDN-SCfPiLILYTIGWICFCSFSNLINVPLTNVTLKSVDEEDKSLALG 562  Helobdella ro...
Q71MB6        617 VQFMLLRLLGTIPGPIIFGVTIDSTCVLW-DiNEC-GTKGACWIYDNIRM 664  Norway rat
EFZ17735      573 FWMTWMGIFVHIFGKLLYEFVSRQACQYW-G-SQ----KAICHLHDSEKL 616  red fire ant
XP_786158     653 FSNVLMKLLAFIPGPVYFGAIIEKTCLLF-Q-ESC-GKTGNCLVYDIKAF 699  purple sea urchin
XP_003136931  549 FASCITNIMGFIPGPIIFGWIIDEDCLLW-H-SNCpHDRGNCVIYDNKAF 596  eye worm
CDP94209      524 FASCTTNIMGFIPGPIIFGWIIDEDCLLW-H-SKCpHDHGNCVIYDNKAF 571  Brugia malayi
ERG81202      559 FASCITNVLGFIPAPILFGWIIDSACILW-R-SRCpKDPGNCVIYDNKFF 606  pig roundworm
KKA71215          --------------------------------------------------      Pristionchus pacificus
NP_509659     539 LASFITNLFGFIPAPVIYGFFIDLCCILW-N-RQCpNERGNCVLYDNDMF 586  Caenorhabditis elegans
KKA73383      680 LQGFMISLFGTLPSPIIWGAIVDSTCLIW-D-HACdGARGSCSLYDPAAL 727  Pristionchus pacificus
XP_009019373  563 LQLIII-CVSVFPFTLIFGHMIDWTCILWkT-TSCsDAVGSCLAYDHSKF 610  Helobdella robusta
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap