Conserved Protein Domain Family
Herpes_ICP4_N

?
pfam03584: Herpes_ICP4_N (this model, PSSM-Id:281569 is obsolete and has been replaced by 367571)
Herpesvirus ICP4-like protein N-terminal region
The immediate-early protein ICP4 (infected-cell polypeptide 4) is required for efficient transcription of early and late viral genes and is thus essential for productive infection. ICP4 is a large phosphoprotein that binds DNA in a sequence specific manner as a homodimer. ICP4 represses transcription from LAT, ICP4 and ORF-P that have high-affinity a ICP4 binding site that spans the transcription initiation site. ICP4 proteins have two highly conserved regions, this family contains the N-terminal region that contains sites for DNA binding and homodimerization.
Statistics
?
PSSM-Id: 281569
Aligned: 4 rows
Threshold Bit Score: 204.296
Threshold Setting Gi: 81987336
Created: 21-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9DGT6 1188 CGSVWWEVPLPPPGRCWFGGLGGHRQALTDSPEIVEAIHRFNTSHGPVPVYVEEMKDYAKQYDALVNSLFhkSMKVNPLN 1267 Marek's disease her...
P09310  465 DGSPWPGSAPLPSNRVRFGPSGETREGHWEDEAVRAARARYEASTEPVPLYVPELGDPARQYRALINLIY--CPDRDPIA 542  Human herpesvirus 3...
P90493  369 SGEPWPGAGPPPPGRVLYGGLGDSRPGLWGAPEAEEARARFEASGAPAPVWAPELGDAAQQYALITRLLY--TPDAEAMG 446  Human herpesvirus 2...
Q6UDF2  625 DEALLPK--PPAADYVYYGKTG-YRPSMAAHPDVRRAAEEFSASDAAARVYVEEFGMAVEQHERLVAEFM-----LQPLS 696  Psittacid herpesvir...
Q9DGT6 1268 WMHH----GKLSPADAALNHIYvQKFQSSYDsPGAAVTG------------TVNRCIPHIAGAMKERKLLWAFPHIAASI 1331 Marek's disease her...
P09310  543 WLQN----PKLTGVNSALNQFY-QKLLPPGR-AGTAVTG------------SVASPVPHVGEAMATGEALWALPHAAAAV 604  Human herpesvirus 3...
P90493  447 WLQN----PRVAPGDVALDQAC-FRISGAARnSSSFISG------------SVARAVPHLGYAMAAGRFGWGLAHVAAAV 509  Human herpesvirus 2...
Q6UDF2  697 RVSHsyggSRLNKTEKNLCKIClPPDGGDDRdGGGKSRGgrgggskdasrtAMATGVPHIVHAMRDGRAALALPHLMDVI 776  Psittacid herpesvir...
Q9DGT6 1332 AMTRRYCKDQKTFLFRSLKKAYASMAFPDnS 1362 Marek's disease herpesvirus type 1 strain MD5
P09310  605 AMSRRYDRAQKHFILQSLRRAFASMAYPE-A 634  Human herpesvirus 3 strain Dumas
P90493  510 AMSRRYDRAQKGFLLTSLRRAYAPLLAREnA 540  Human herpesvirus 2 strain HG52
Q6UDF2  777 RVCRRYDASQKTYLLSCLRLAFAPLVFPGaS 807  Psittacid herpesvirus 1 Amazon parrot/1997
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap