Conserved Protein Domain Family
Cgr1

?
pfam03879: Cgr1 (this model, PSSM-Id:281823 is obsolete and has been replaced by 397798)
Cgr1 family
Members of this family are coiled-coil proteins that are involved in pre-rRNA processing.
Statistics
?
PSSM-Id: 281823
View PSSM: pfam03879
Aligned: 81 rows
Threshold Bit Score: 41.7845
Threshold Setting Gi: 541038949
Created: 11-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2HDR6        19 PLGMRKNGKQWHAPKKAF-----------------RPGSG--------LTSYEQRAKTRVAQAATKAKEKELKEEKEAER 73  Chaetomium glob...
P0CM66        22 SKNGRTPGKAHKSAKTALr----------------RSYISps-----vkTPFEKRMEKEKAQQAAKQLEKELKEEKENER 80  Cryptococcus ne...
XP_003037236  58 SSGGRVSGKAWKPQKKATv----------------RSHIQeg----vrTKNWEDRMEKEKKAQAIKKLQAELKEEQEAER 117 Schizophyllum c...
EPT03988      32 SSTGRVSGKSWKHQKSATv----------------RTMLPdg----vkSKSWDDRMQKAQKEKAIKKLQAELSEEKRAEK 91  Fomitopsis pini...
CCA75298      11 SSSGRVSGKNWKTRKTATv----------------RSNLPtg----vkTKSWQERKRKDTQMAAVKALQKELKDEKLAEI 70  Piriformospora ...
XP_007312792  99 SSNGKLSGKPWKALKTATv----------------RSQCSig----hkAKSWQDRMEKTKKEHAIKKLETELKDEKKADI 158 Serpula lacryma...
XP_007842692   7 svNGRVSGKPWKAQKSATv----------------RSHLPng----vkAKSFAARMEQVKKAHAIKKLQQELSDEKQAEK 66  Moniliophthora ...
EMS19309      34 qSSTNVSGRWWKTEHKAT-----------------TRVQSgkkapqqlDKAWKQREERRKRDEAIKKLERELKQEKEDEA 96  Rhodosporidium ...
XP_001829046  17 SSGGRVSGKPWKLQKTAT-----------------VRSHLqp----glRTKFEERKEKETKAKALKKLQAELREEKQAEI 75  Coprinopsis cin...
XP_001873336  10 ssaGRVSGKSWKTAKTATvsadsrfnflhanvpnsRSNLPda----vkTKKWEDRMQKTTKAMAIKKLQTELKDEKEADY 85  Laccaria bicolo...
Q2HDR6        74 KRRMQALVEKRAAKAEKERYELLAAKMHKKRLERLKRKEKRNKVLNS 120 Chaetomium globosum CBS 148.51
P0CM66        81 QRKVNIIKERRARKEEKQREEELRAKMSAKKLQRMKKREGRSKKINg 127 Cryptococcus neoformans var. neoformans JEC21
XP_003037236 118 KARIDRIKERRAKAEERERIEMEKAKMGARKAARLRRRQGRTKKINH 164 Schizophyllum commune H4-8
EPT03988      92 ERRKQITLERKKAAEERRRLEEDKAKMGARKAARLRRKAGRTKKINH 138 Fomitopsis pinicola FP-58527 SS1
CCA75298      71 QRRKEITKERKERAEERKRLEEMKAKMSAKKLARMRRRQGRTKKINg 117 Piriformospora indica DSM 11827
XP_007312792 159 KRRRDITLARRNAAEERLRLEEEKAKDGCKKSRQAETESRKDKEDKR 205 Serpula lacrymans var. lacrymans S7.9
XP_007842692  67 DRRREITLERRKAAEEKKRLEEDKARMGARKTARLRRKQGLTKKISH 113 Moniliophthora roreri MCA 2997
EMS19309      97 DRKKRINLERREKEAEKKRLAEMAARMSAKKLQRMKKRLGRSKKVSg 143 Rhodosporidium toruloides NP11
XP_001829046  76 DRRRQITLERKRAAEEKLRVEEAKAKMGARKAARLRRRAGRSKTVNH 122 Coprinopsis cinerea okayama7#130
XP_001873336  86 QRRREVTMERKKAAEERRRLEDAKAQMGARKAARLRRRAGRTKKVNH 132 Laccaria bicolor S238N-H82
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap