Conserved Protein Domain Family
Herpes_BLLF1

?
pfam05109: Herpes_BLLF1 
Herpes virus major outer envelope glycoprotein (BLLF1)
This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.
Statistics
?
PSSM-Id: 282904
View PSSM: pfam05109
Aligned: 2 rows
Threshold Bit Score: 1405.05
Threshold Setting Gi: 55584119
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P68343   1 MEAALLVCQYTIQSLIQLTRDDPGFFNVEILEFPFYPACNVCTADVNATINFDVGGKKHKLNLDFGLLTPHTKAVYQPRG 80  Epstein-barr virus st...
P68343   1 MEAALLVCQYTIQSLIQLTRDDPGFFNVEILEFPFYPACNVCTADVNATINFDVGGKKHKLNLDFGLLTPHTKAVYQPRG 80  Epstein-barr virus st...
P68343  81 AFGGSENATNLFLLELLGAGELALTMRSKKLPINITTGEEQQVSLESVDVYFQDVFGTMWCHHAEMQNPVYLIPETVPYI 160 Epstein-barr virus st...
P68343  81 AFGGSENATNLFLLELLGAGELALTMRSKKLPINITTGEEQQVSLESVDVYFQDVFGTMWCHHAEMQNPVYLIPETVPYI 160 Epstein-barr virus st...
P68343 161 KWDNCNSTNITAVVRAQGLDVTLPLSLPTSAQDSNFSVKTEMLGNEIDIECIMEDGEISQVLPGDNKFNITCSGYESHVP 240 Epstein-barr virus st...
P68343 161 KWDNCNSTNITAVVRAQGLDVTLPLSLPTSAQDSNFSVKTEMLGNEIDIECIMEDGEISQVLPGDNKFNITCSGYESHVP 240 Epstein-barr virus st...
P68343 241 SGGILTSTSPVATPIPGTGYAYSLRLTPRPVSRFLGNNSILYVFYSGNGPKASGGDYCIQSNIVFSDEIPASQDMPTNTT 320 Epstein-barr virus st...
P68343 241 SGGILTSTSPVATPIPGTGYAYSLRLTPRPVSRFLGNNSILYVFYSGNGPKASGGDYCIQSNIVFSDEIPASQDMPTNTT 320 Epstein-barr virus st...
P68343 321 DITYVGDNATYSVPMVTSEDANSPNVTVTAFWAWPNNTETDFKCKWTLTSGTPSGCENISGAFASNRTFDITVSGLGTAP 400 Epstein-barr virus st...
P68343 321 DITYVGDNATYSVPMVTSEDANSPNVTVTAFWAWPNNTETDFKCKWTLTSGTPSGCENISGAFASNRTFDITVSGLGTAP 400 Epstein-barr virus st...
P68343 401 KTLIITRTATNATTTTHKVIFSKAPESTTTSPTLNTTGFAAPNTTTGLPSSTHVPTNLTAPASTGPTVSTADVTSPTPAG 480 Epstein-barr virus st...
P68343 401 KTLIITRTATNATTTTHKVIFSKAPESTTTSPTLNTTGFAAPNTTTGLPSSTHVPTNLTAPASTGPTVSTADVTSPTPAG 480 Epstein-barr virus st...
P68343 481 TTSGASPVTPSPSPRDNGTESKAPDMTSPTSAVTTPTPNATSPTPAVTTPTPNATSPTLGKTSPTSAVTTPTPNATSPTP 560 Epstein-barr virus st...
P68343 481 TTSGASPVTPSPSPRDNGTESKAPDMTSPTSAVTTPTPNATSPTPAVTTPTPNATSPTLGKTSPTSAVTTPTPNATSPTP 560 Epstein-barr virus st...
P68343 561 AVTTPTPNATIPTLGKTSPTSAVTTPTPNATSPTVGETSPQANTTNHTLGGTSSTPVVTSPPKNATSAVTTGQHNITSSS 640 Epstein-barr virus st...
P68343 561 AVTTPTPNATIPTLGKTSPTSAVTTPTPNATSPTVGETSPQANTTNHTLGGTSSTPVVTSPPKNATSAVTTGQHNITSSS 640 Epstein-barr virus st...
P68343 641 TSSMSLRPSSISETLSPSTSDNSTSHMPLLTSAHPTGGENITQVTPASTSTHHVSTSSPAPRPGTTSQASGPGNSSTSTK 720 Epstein-barr virus st...
P68343 641 TSSMSLRPSSISETLSPSTSDNSTSHMPLLTSAHPTGGENITQVTPASTSTHHVSTSSPAPRPGTTSQASGPGNSSTSTK 720 Epstein-barr virus st...
P68343 721 PGEVNVTKGTPPKNATSPQAPSGQKTAVPTVTSTGGKANSTTGGKHTTGHGARTSTEPTTDYGGDSTTPRTRYNATTYLP 800 Epstein-barr virus st...
P68343 721 PGEVNVTKGTPPKNATSPQAPSGQKTAVPTVTSTGGKANSTTGGKHTTGHGARTSTEPTTDYGGDSTTPRTRYNATTYLP 800 Epstein-barr virus st...
P68343 801 PSTSSKLRPRWTFTSPPVTTAQATVPVPPTSQPRFSNLSMLVLQWASLAVLTLLLLLVMADCAFRRNLSTSHTYTTPPYD 880 Epstein-barr virus st...
P68343 801 PSTSSKLRPRWTFTSPPVTTAQATVPVPPTSQPRFSNLSMLVLQWASLAVLTLLLLLVMADCAFRRNLSTSHTYTTPPYD 880 Epstein-barr virus st...
P68343 881 DAETYV 886 Epstein-barr virus strain ag876
P68343 881 DAETYV 886 Epstein-barr virus strain ag876
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap