Conserved Protein Domain Family
NPIP

?
pfam06409: NPIP (this model, PSSM-Id:283949 is obsolete and has been replaced by 399422)
Nuclear pore complex interacting protein (NPIP)
This family consists of a series of primate specific nuclear pore complex interacting protein (NPIP) sequences. The function of this family is unknown but is well conserved from African apes to humans.
Statistics
?
PSSM-Id: 283949
View PSSM: pfam06409
Aligned: 2 rows
Threshold Bit Score: 529.257
Threshold Setting Gi: 550540850
Created: 16-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
F8WFD2         22 VINTLADHRHRGTDFGGSPWLLIITVFLRSYKFAISLCTSYLCVSFLKTIFPSQNGHDGSTDVQQRARRSNRRRQEGIKI 101  human
XP_001109190   22 VINSLPDHFQPGPDFFGIPWIAIIIVFLGISTLGIFLWKTSFGVSFLKTVLKLQNVHDRSTDVQRRAWRSNSRSQEGIKI 101  Rhesus monkey
F8WFD2        102 VLEDIFTLWRQVETKVRAKIckMKVTTKVNRHDKINGKRKTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTY 181  human
XP_001109190  102 GLEDLFTSWRYMEAKVRAEV--HKVTTKVNSHYQIHGQRKTTEEHLRKLRMKECEQAEKERQLSDAEENGKLVMKKIRTY 179  Rhesus monkey
F8WFD2        182 MEMFQRAQALRRRAEDYYRCKITPSARKPLCNRVRMAAAEHRHSSGLPYWPYLTAETLKNRMGHQPPPPTQQHSIIDNSL 261  human
XP_001109190  180 KKMFQDMQQLQWRTEDSYRCKITPYARKALDNWVSMVAVEHHHSSGLRYSPYLMAEPLRQWMGHQPPPPSQYHLGAQPLP 259  Rhesus monkey
F8WFD2        262 SLK--------TPPECLLTPLPPSalpSADDNLK 287  human
XP_001109190  260 SAKgflgpltiSQLECPLGPQPPS---TTDDFLR 290  Rhesus monkey
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap