4MH6


Conserved Protein Domain Family
YscO

?
pfam07321: YscO (this model, PSSM-Id:284686 is obsolete and has been replaced by 399954)
Click on image for an interactive view with Cn3D
Type III secretion protein YscO
This family contains the bacterial type III secretion protein YscO, which is approximately 150 residues long. YscO has been shown to be required for high-level expression and secretion of the anti-host proteins V antigen and Yops in Yersinia pestis.
Statistics
?
PSSM-Id: 284686
View PSSM: pfam07321
Aligned: 13 rows
Threshold Bit Score: 76.2642
Threshold Setting Gi: 503715001
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4MH6_A         26 IERLLEIKKIRADRADKAVQRQEYRVANVAAELQKAERSVADYHVWRQEEEERRFAKAKQQTVLLKELETLR----QEIA 101  Vibrio paraha...
Q2SC35          2 LSALADIKKLRERNAQAEALRKRQLLTQSREKVEEAQRDLQQFEIWRVQEEHRLYDSIMGSEVGLKAIDKVK----HQIG 77   Hahella cheju...
Q2SH49          2 IASIAEIKQHRTNRQARQVKSLEIALSDLRERRSQSAHAFTDFQQWRRRESDRLFAELAGKPASLQEVDDYN----SRVT 77   Hahella cheju...
Q9I331          3 LALLLRVRRLRLDRAERAQGRQLLRVRAAAQEHTERQAAQRDYRDWRLAEEQRLFLACQAAMLDRRRLEAWQ----QQVG 78   Pseudomonas a...
Q7N0W1          2 ISRLQRIKALRVERAEKHFSLQQMKLQTARQHHQQALQTLQDYCQWRIEEEQRLFALCQGQPIDRKGLERWQ----QQVA 77   Photorhabdus ...
O30878          2 IRRLHRVKVLRVERAEKAIKTQQACLQAAHRRHQEAVQTSQDYHLWRIDEEQRLFDQRKNTTLNCKDLEKWQ----RQIA 77   Yersinia pestis
Q4CP84       1222 PRNFLKVESAEKREEEKVQKR---------PAHRSTSSSSAPIRALLADADANIIVKPQIAAMLQREIEKAQrnnmHEIS 1292 Trypanosoma c...
WP_015946069    7 LQPLLNVRHFRENGARNALMTAEGVLRDAMQAAEDRRAELERYRAWRPGEEERRYDAIMGTSMAVEDLDRFK----AGLA 82   Desulfovibrio...
WP_011526622    6 LAPLLSVREHKEELAQQAVLRAENALVEARKDLQKAEEDCKNYEEWCQQEINRYYSEIIGSLVLFKELELLK----VKTG 81   Lawsonia intr...
WP_043680384    4 FRELIAIKRFREGQAELAMMRQRQVLAEAERLRLQAVEHLDEYRRWSEQRELDMYRDLCSRLVRASEIEDVL----ENVA 79   Castellaniell...
WP_003820063    3 LESLLAIKHFRADQAQLALKRQQQACAVAAAAQRQAQGRLDDCRLWAGQLENRLYAELCRRIVKTRDIDEVL----QRVG 78   Bordetella
WP_014286152    5 IKKLHLVKTLKEQKAQRELNAELEKVRRAKEQLEQKRKTAADERATLPAKQDALYEEIIKKVISTDDLDKVK----EQAQ 80   Pseudovibrio ...
WP_013949077    6 IRQVQRVKVLQADRAEQEERARRAGLEAAAAAVETARANLERWREEMPRREAAIYDAIIGKLVDLEALDACK----ARVV 81   Hyphomicrobiu...
4MH6_A        102 LLREREAELKQRVAEVKVTLEQERTLLKQKQQEALQAHKTKEKFVQLQQQEIAEQSRQQQYQEELEQEEFRTV 174  Vibrio parahaemolyti...
Q2SC35         78 MLRLKEVSLAEQVEKARQEQKQAEAALRQAEQALAEAGKAVEKCQMLIEQVSADAIAEAQRLEELELEEASET 150  Hahella chejuensis K...
Q2SH49         78 YFKVQSNDLASQLKQIQAQETAAEQKLQAALDQLKAAQRAQEKFAILAEDFQGALQQNRIRLEEQQAEEMAAD 150  Hahella chejuensis K...
Q9I331         79 LLREKEAGLEQDCAEAAQRLEGERERLRQCRRELLERQRQLEKFAELERHVDAERQGLRERSEEGELEEFTRH 151  Pseudomonas aeruginosa
Q7N0W1         78 LLRENEAQLEKQVAEMTEKVELELRQLKECQRVLHHTRQQQEKFNELGRQQQEAIRAQGEYQEELEQEEFHRQ 150  Photorhabdus lumines...
O30878         78 SLREKEANYELECAKLLERLANERERLTLCQKMLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQH 150  Yersinia pestis
Q4CP84       1293 SLRANVRRLESDLEEARQQLRGERDNSRSLRVMVQNARRELEE--KELALVRTSASRQQRAKEHQHVQANFVT 1363 Trypanosoma cruzi
WP_015946069   83 ALAQAELQREQAVADADRRVEECRKAVADARAAVAKARREVAKIAAHKDIWSEEMRRETERLADIEMEEFKAV 155  Desulfovibrio vulgaris
WP_011526622   82 ILLDNVKEKYKLVDKAKDYVEACIEAKERAIKNLTELKKQTAKLAEHKKLWEAEEKILAQQREEVELEDFKMP 154  Lawsonia intracellul...
WP_043680384   80 GLREGEQDRETRVEEAENQAHREAETLTQCREAHREASRMVEKFVQLASLHAAEELRELERKEDLEMEEAASV 152  Castellaniella defra...
WP_003820063   79 HARDRQASLALQLDDAVRRHEHEIQLLAQQREQHRECFQAQQRIAELVRLQQVEAAALRESQEDREIQEAIEl 151  Bordetella
WP_014286152   81 ILENAVKKLEDAAERAAYVYDRALKNADAARLEYQKALRIKDKYGKVADDLRSEANALMEAAEEqeieeqfsg 153  Pseudovibrio sp. FO-...
WP_013949077   82 ELREHEALLAKRLQDAEGAATAAREALEFASQKLAHARRAVSKFDELVATLRAAELLDAEAKEDAeleeaaea 154  Hyphomicrobium sp. MC1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap