Conserved Protein Domain Family
7TM-7TMR_HD

?
pfam07698: 7TM-7TMR_HD (this model, PSSM-Id:285000 is obsolete and has been replaced by 400165)
7TM receptor with intracellular HD hydrolase
These bacterial 7TM receptor proteins have an intracellular pfam01966. This entry corresponds to the 7 helix transmembrane domain. These proteins also contain an N-terminal extracellular domain.
Statistics
?
PSSM-Id: 285000
View PSSM: pfam07698
Aligned: 72 rows
Threshold Bit Score: 52.9395
Threshold Setting Gi: 147848446
Created: 14-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2LTL3       330 LSVFLGIFLTIILLSLVLYYWRIRNwpKKYARSNVDLLFLSTTAFFQILLVKTgifmsdaINRAfpyl---smetCFFAI 406 Syntrophus acid...
Q6MBQ8       247 PFTMLGSLIFTVLFIGIFLSYFQTNq-PRILKSNRKIFLLVTILVLTLILSKF-------TEFFllnsknnlidtIRYPL 318 Candidatus Prot...
Q2S2D8       354 AKQLSGEVLFTLLGFGFFFFYLYLLr-PEIWSKNRDLVLVSVVLAFIILLYGI---------Aira-------pwSLYVV 416 Salinibacter ru...
Q5L882       264 rlILGGQILFVGILILCFMLYLELFr-KDYYERKGSLSLLFALIVFYCVITALmv----tNNi-----------fNVYIL 327 Bacteroides fra...
Q7MUD7       253 FTRNLGIFLIIFFLLLALWAYMLSFr-PVFFDRLHNSFFVLSLILVINLITELai----sFGw-----------fNIYII 316 Porphyromonas g...
WP_022322610 255 giIMGGQFVLAFGILFCFWLYLWSFr-LKILHNRRNALFLVLCVFVSCILTELcv----tYGLF-----------NVYIL 318 Parabacteroides...
WP_005845464 264 rLTLAGQILYVGIFLFCFMAYLELFr-ADYYERKGTLTLLFALIVFFPVLSSImv----eQNLS-----------SIYVV 327 Bacteroides
WP_015754564 264 YFILSGYTILVALVLIMLLLFLKRYr-PDVFRNNVKVTFIFFNILVMVFLTTFvv----kYNEA-----------LVFVV 327 Robiginitalea b...
WP_011709393 264 nWIIVGYSTLVALALLMLLLFMRKYr-MSIFENNVKVTFIFFNIIFMVMLTTLav----sFNID-----------YVYVV 327 Gramella forsetii
WP_013188109 264 YWVIFGYTILVSLALLMLLLFIKKYr-IEIFENNTQITFIFFNVLVMVLLTTLvv----kYNPE-----------FVYLV 327 Croceibacter at...
Q2LTL3       407 PFAAGAMLVAVLTNRNMALILNIFISFLISFL-FEYDIKMSLFCFLGSIAASYHVVRCRQRSAFLKAGLYLGFFNIAVIA 485 Syntrophus acid...
Q6MBQ8       319 FIPLAAILICSLINPAVATFSAGFLSVVSSISlAFDWEGFLLLNLTAGLVAILSVHSLRRRKEIFVVCLNAWICCVIAIL 398 Candidatus Prot...
Q2S2D8       417 PVPLASVLLTIVFNSRIALIGTLVLALTGGQMl-GLELEYTVATFFAGAFGIFSVRDIKNRGQFFVSGGLAFAGYALVLF 495 Salinibacter ru...
Q5L882       328 PYAMLPIIIRVFLDSRTAFLTHVITILICSIT-LRYPHEFILTQIAAGLVAIFSLRELSQRSQLFRTALLVILTYAAIYF 406 Bacteroides fra...
Q7MUD7       317 PFIILPILVRTFHDSRTAFFAHVINVLIVAMF-VPDIYEFILLQVLAGIVSVTSMRRLTSRLQLVRTTFLVFLTYSVVQL 395 Porphyromonas g...
WP_022322610 319 PFAIVPIVVRTFFDSRTALFTHLIIVLICSLM-VPFPHEFLLLQVIAGMVVTFSLRDLYERSQLIRCAFFIFMSYALCYI 397 Parabacteroides...
WP_005845464 328 PFAMIPIIVRVFLDSRTAFMAHVTIILLCSIT-LRFPHEFILLQVVAGMVAIYSLRELSQRSQLLRTALVVFISYALLYF 406 Bacteroides
WP_015754564 328 PLCILPLILKTFFDARLGLFVHVLTVLILGFV-VPNSFEYIFLQIIAGIVTILTVSELYKRANLFISVGQITLIYILGYF 406 Robiginitalea b...
WP_011709393 328 PLCILPLTLKAFFDARLGLFTHVITVLLLGFI-VPNSYEYMFLQIIAGIVTILTVSELYKRANLFISVGQITLVYIIAYF 406 Gramella forsetii
WP_013188109 328 PLCILPLTLKAFFDARLGLFTHVITVLLLGFI-VPNSYEYMFLQILAGIVTILTVSELYKRANLFISVAQITLVYILAYF 406 Croceibacter at...
Q2LTL3       486 CISLIMNEIFS-FDLFSKLAMGMAGGLLSGVIVAGMTPLFETIFKYTT 532 Syntrophus aciditrophicus SB
Q6MBQ8       399 ASHLYHNSI-GhFSMVADILSACFFMLFTAVLGVGLLPLLESGFRIMT 445 Candidatus Protochlamydia amoebophila UWE25
Q2S2D8       496 ATWLYLDLPf--GRVAPDLAYAAIASAIT-ITSSLFLWALERIFDITT 540 Salinibacter ruber DSM 13855
Q5L882       407 AFELISENDLS--KLNVSMYIYFIINGVLLLFAYPLLFLLEKTFGFTS 452 Bacteroides fragilis NCTC 9343
Q7MUD7       396 SFSLMQDGRVE--MGDGLNILYFGVNLIFLMFSYLLVYLMERAFGYVS 441 Porphyromonas gingivalis
WP_022322610 398 SLSIYQEADF--KKINWMMMLYFGINFILLMFTYILVYMLEKTFGYVS 443 Parabacteroides merdae CAG:48
WP_005845464 407 AFELIHEDDLT--KLNTRMYIYFMINGILLLFAYPLLFLLEKIFGFTS 452 Bacteroides
WP_015754564 407 AFNIIQGGSLD-NVVWVNFGFFLLNGMI-TLFVQPLIYIYEKMFGMVS 452 Robiginitalea biformata
WP_011709393 407 AFTVIQEGNID--DMKPEVFLTFLLGGLATLFVQPLIYVYEKIFGMVS 452 Gramella forsetii
WP_013188109 407 AFTITREGTVT--AMNWETILYFVTCGLATLFVQPLIYAFEKVFGMVS 452 Croceibacter atlanticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap