Conserved Protein Domain Family
CortBP2

?
pfam09727: CortBP2 (this model, PSSM-Id:286770 is obsolete and has been replaced by 337491)
Cortactin-binding protein-2
This entry is the first approximately 250 residues of cortactin-binding protein 2. In addition to being a positional candidate for autism this protein is expressed at highest levels in the brain in humans. The human protein has six associated ankyrin repeat domains pfam00023 towards the C-terminus which act as protein-protein interaction domains.
Statistics
?
PSSM-Id: 286770
View PSSM: pfam09727
Aligned: 39 rows
Threshold Bit Score: 171.606
Threshold Setting Gi: 313232658
Created: 27-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q179Y2         2 DFSKTDLLKLLSYLEGELQARDVVIAVLKTEKVKQLLNTARYSKPTNlNDPHAALYRDNlassgniasrqSSIQAAYSEH 81   yellow fever m...
XP_005389012   5 KLSKPELLTLFSILEGELEARDLVIEALKAQHRDT-FIEERYGKYNI-SDPLMALQRDFe----------TLKEKNDGE- 71   long-tailed ch...
XP_003454327  20 sLSKPELLMLFSILEGELEARDLVIEALKAQR-KELFIQERYGRYNL-SDPFQALQRDSe----------AVGGQDKEAG 87   Nile tilapia
XP_006628428   5 NLSKPELLMLFSVLEGELEARDLVIEALRAQH-RDAFVQERYGKYNL-SDPFLALQRDNe----------VGRGLAQPER 72   spotted gar
XP_005811290  10 aLSRAELLTLLSILEGELEAQDVVIHTLRAQH-RDEFVQDRYGEYDL-SDPFLALQRDEe----------AAERQTTIR- 76   southern platy...
XP_002125885  88 NLSRDELLKLLSVFEGELQARDEVISILKTECSQN--PETRYG--LT-SQPLKALQRDAa----------SLDLTTQTPE 152  vase tunicate
XP_002119326  40 KLSKGELLRLLSILEGELEARDIYITTLQAQ-LNVGHANARYFQHKI-RDPFLALIRDNe----------AMNGNVTTDT 107  vase tunicate
CBY19328      22 KLTHDELLRLCSVFEGELQARDKAITILKQQLRQV-------------NTAREALKRDEf----------INASAKKTSD 78   Oikopleura dioica
XP_003448340  10 ALSRAELLTLLSILEGELEAQDVVIHTLRAQH-KDAFVQERYG-QYDlSDPFLALQRDNe----------AMECQNTAA- 76   Nile tilapia
XP_010745068  10 ALSRAELLTLLSILEGELEAQDVVIHALRAQH-RDAFVQERYG-QYDlSDPFLALQRDNe----------SEERQNTLT- 76   large yellow c...
Q179Y2        82 EMRllndqrlgvkEQMDSLAALVMQQRQTQAKMVEVLKDAEERYKKVVQELEEERRKHEHTTAQGDDITYGLEIERSRLK 161  yellow fever m...
XP_005389012  72 -KQpv------ctNPLSILKVVMKQCKNMQERMLSQLAAAESRHRKVILDLEEERQRHAQDTAEGDDVTYMLEKERERLT 144  long-tailed ch...
XP_003454327  88 CSSst-------sNPLVVLKLVVSHCRRMQEKMLAQLAAAESRHRRVIADLEEEKRKHAEDTAEGDDVTYILEKERERLQ 160  Nile tilapia
XP_006628428  73 --Gpl------csSPLTILKLVMSHCKRMQERMLAQLAAAESRHRKVIADLEEEKRRHAQDTAEGDDVTYMLEKERERLL 144  spotted gar
XP_005811290  77 QPQthplgravgpNPLAVLKLVMTHCKRMQERMMGQLAAAESRHRRMITALEEEKQRFVQESARRADYVFVLETERDKLL 156  southern platy...
XP_002125885 153 s-----------eQTKEQMKKIIQHQKDSYKRLKQILLTSEDKYQRMGIELEEEKRKHQEYMMKSDDFVNLLEHDRERLK 221  vase tunicate
XP_002119326 108 NFTripmlntktmQPLPLLEKLIQQFKNQQNKLQQHVALGEMYYQLVNEELLRTKRLHV----QANDTEN-LRKEQIKLR 182  vase tunicate
CBY19328      79 DEKt--------gNTVGQLKSIIEHQKDSMRKLKREMCSSEQKHHQLMEEFGKEKRKHQEYMDKSDEFVNLLEADRQKMK 150  Oikopleura dioica
XP_003448340  77 EPHthlqgravgpNPLAVLKLVMAHCKRMQERMMGQLAAAENRHRRMIADLEEEKRRHVQESAHHADFTFMLQTERDKLL 156  Nile tilapia
XP_010745068  77 QPHahlqgravgpNPLAVLKLVMAHCKRMQERMMGQLAAAESRHRRMIADLEEEKRRHAQDSAHSDDFTFMLQTERDKLL 156  large yellow c...
Q179Y2       162 QELEHEKEQRKVLELELQKIQEQFEEEKNRQKQIVLLLLAERKK 205  yellow fever mosquito
XP_005389012 145 QQLEFEKSQVKKFEKEQKKLSSQLEEERSRHKQLSSMLVLECKK 188  long-tailed chinchilla
XP_003454327 161 QQLDFERSQVRRLEKEQRRISDQLEEERAQHKQLSCALAKECKw 204  Nile tilapia
XP_006628428 145 QQLDFEKAQVKRLEKEQKKLSGQAEEDRAQHKQLSSALAKECKR 188  spotted gar
XP_005811290 157 QQLEVELATVQRLEKEQAQVVSKVEESLSQEQQLSSSLTLELQK 200  southern platyfish
XP_002125885 222 QIIEREKSTHDRKERELVRKLRENKDELSRLKSLSLELVEERQR 265  vase tunicate
XP_002119326 183 TLAFLEQKKVKHVANEYKKLLQIISSERKKYRMILSLLLEEKac 226  vase tunicate
CBY19328     151 LLLEEEKTRYDGMSRSFEKLKKDSGEEIEKLKKFSMLLVEEKQa 194  Oikopleura dioica
XP_003448340 157 QQLEVERTTVQRLEKDKAQVVSKVEESLSQQQQLSSTLTLElqk 200  Nile tilapia
XP_010745068 157 QQLEVEHATVQRLEKEQAQAVSKVEESLSQQQQLTSTLstelqk 200  large yellow croaker
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap