Conserved Protein Domain Family
PI3K_1B_p101

?
pfam10486: PI3K_1B_p101 (this model, PSSM-Id:287460 is obsolete and has been replaced by 402214)
Phosphoinositide 3-kinase gamma adapter protein p101 subunit
Class I PI3Ks are dual-specific lipid and protein kinases involved in numerous intracellular signaling pathways. Class IB PI3K, p110gamma, is mainly activated by seven-transmembrane G-protein-coupled receptors (GPCRs), through its regulatory subunit p101 and G-protein beta-gamma subunits.
Statistics
?
PSSM-Id: 287460
Aligned: 15 rows
Threshold Bit Score: 1266.91
Threshold Setting Gi: 765129059
Created: 15-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5ZIB8         4 TTCTEDRIYHALERCLHGLSRDAV-S-SRWAA-----GLCLNCWSLQELVSRDAGNYLILVEKILGKAREVQEKCDYDLV 76  chicken
XP_005470045   4 TSCTEDRIQHALDRCLDGLRQSPTaA-HHWNVlmcsvGQSMNRWSLEELVKRDPDNFIILLQQIIRKTREVQEQCQYELV 82  Nile tilapia
XP_011610738   5 TSCTEDRIQHALDMCLDGLRKSPAsA-HNWNA-----GQSMNRWSLEEMVKRDPDNFLILLQQIIRKAREVLEECQYELV 78  torafugu
XP_005797615   4 TTCTEDRIQHALDRCLDGLRQMLMcS-----A-----GQSMNRWSLEELVKRDPENFLILLQQIIRKTKEAQDQCQYELV 73  southern platyfish
XP_006635512   4 TSCTEDRIHHALERCLHRLSQSSS-A-DTWSA-----GLCMNRWSLEELVNRDPENFLILLQQILKKTREVQEQCEYILV 76  spotted gar
XP_001366777   6 TTCTEDRIQHALERCLHGLSVSRG-T-TTWTA-----GLCLNCWSLQELVSRDPDNFLILLEQILQKTTEVQEKCSYDLL 78  gray short-tail...
NP_055123      6 TTCTEDRIQHALERCLHGLSLSRR-S-TSWSA-----GLCLNCWSLQELVSRDPGHFLILLEQILQKTREVQEKGTYDLL 78  human
XP_003217124   4 TTCTEDRIHHALERCLHGLSKSGTiSaSTWTA-----GLCLNCWSLQELVSRDAGNYLILLEKILQKTQEVHDKCDYDLF 78  green anole
NP_001039143   4 TSCTEDRIQHALERCLHGLGGNTDfS-SNWTA-----GLCLNYWSLEELVNRDATNYIILAEKTLERTREAQENGEYELL 77  western clawed ...
XP_003443226   7 SSCTEDRIQHVLERCLSHLGVDTPdT-QLWKA-----GLCINRWSLEELVKRDPHNFLILLQQILRKTKEVLEQCQYELV 80  Nile tilapia
Q5ZIB8        77 MPLALLFYYAVLYAPHIPPDSELLLKAASIYHSFLTWPVPYCDVFRELLTFISDELKAPGISFQRLVRTEQGLPVKNYQS 156 chicken
XP_005470045  83 APLAIMFSSTLLQTPYCTDNTDLLEEAMDVFCHFLTWPEPYCSVCKRLLSTIQLEMKAPGISFQRLVRDEQGLNTSIQCS 162 Nile tilapia
XP_011610738  79 APLAIMFSSTLLQTPHCPPDTKLLEEAEEVFRHFLTWPEPFSSVCRNLLTTLQLEQKAPGISFQRLVREEQGIITSSQSS 158 torafugu
XP_005797615  74 APLAIMFTSTLLQTPYCPPDTELLEEALEVFYSFLTWPEPYCSVCRELLSMLQMEIKAPGISFQRLVREEQGLNSSDYTS 153 southern platyfish
XP_006635512  77 APLALMFFSTALQTPYFPPHCDLLREACEVYHSFLTWPEPYCSVCRDLLTFIHQELKAPGISYHRLVREEQGLATDNQQS 156 spotted gar
XP_001366777  79 APLALLFYSTVLCTPHFPPDSDLLLKAARTYHRFLTWPIPYCSICQELLTFIDAELKVPGINYQRLVRAEQGLSIRSHRN 158 gray short-tail...
NP_055123     79 TPLALLFYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRS 158 human
XP_003217124  79 APLALLFGAAVLSIPHFPSDSDLLPRALRIYRDFLTWPVPYCDICQELLTFINNELKAPGISFQRLVRAEQGLPAKTHET 158 green anole
NP_001039143  78 APLALMFYFAVLRAPYIPETSDLLPKAFEGFHTFLTWPAPYCHIFRELLSFISEEQKAPGITYQRLVRAEQGIPTRSSCN 157 western clawed ...
XP_003443226  81 VPLSLLFSSTLLRAPYLPADCGVLQDANLLFHGFLSWPEPCSSAAKRLLNVIQQELRAPGISFQRLVRTEQGISHEIHCS 160 Nile tilapia
Q5ZIB8       157 STVTVLLLNR-SEVQSEFLSIAEKLSSTEPPRHATLVLLLEHLYQVTFGTRCDLGSLHHLLKAKTLEELSEIYTSAAEAQ 235 chicken
XP_005470045 163 KTMTVLLMNP-SEVPADFVSVAEQLSCVQHSQRETYITLIKHAFQSTLGTKYPLHSIHRALQAKPVNELEEIYSLVSDAL 241 Nile tilapia
XP_011610738 159 TTMTVLLMNP-GEVPAEFLSVAEQLSCVQHLQRESYITLIKHCFQSALGTKYPLQHIHRVLQPKPVSELSEIFSEVSDVL 237 torafugu
XP_005797615 154 KTITVLLMNP-DEVPADFLAVAEQLSRIQHSQKDTYITLIKHAFQSALGTKYPLQIIHKALEPKTVSELKEIFSLVSDIL 232 southern platyfish
XP_006635512 157 KTITVLLMNP-SDIPPEFLAVSEQLSNVRHSQKDAYIILIKHAYQSAFGARYPLDCMQKVLESKKVEELSSIFSDITDIL 235 spotted gar
XP_001366777 159 STVTVLLLNP-LEVQAEFLSVANKMSFPEPSPRSTYVTLLQHVYQATFGVCCDLARLHLMLQSKTVTELEAIFEETTEAQ 237 gray short-tail...
NP_055123    159 STVTVLLLNP-VEVQAEFLAVANKLSTPGHSPHSAYTTLLLHAFQATFGAHCDVPGLHCRLQAKTLAELEDIFTETAEAQ 237 human
XP_003217124 159 SIITVLLLNP-SEVDGEFLSVAEKMSTTELSQQTLLVTLLEHIYQANFGTKCDLGKLHQILKLKTVEELMELFASTSEAQ 237 green anole
NP_001039143 158 STVTVLLVNP-AELPSEFLSVAEQLSNAEYPTQQTLISLIQQLLQANLGADAHIEAIGASLKSRPIEKLQEIYSDLTEAM 236 western clawed ...
XP_003443226 161 KTITVLLVSPdDDVPTEVQSVSEQLSVSQHCSRDVTITLILHSFQAALGTKHDLQELHKALQSKQPEELDQILQSLTESM 240 Nile tilapia
Q5ZIB8       236 EIAAASS-D-PVLARERLQSALRDIAGAAALPT-IAGDAQPRRLQPIPIPTSRCYTYSWDQDNFDVLNDVLSKECSVVEP 312 chicken
XP_005470045 242 EAAATMS-E-PLKGRSHVIQGLEKLREMMKIPA-SSGRKSDGMLQTLPLPTAKCYMFNWEKDNFDVLNTLLEHETGYLST 318 Nile tilapia
XP_011610738 238 EAAAATS-C-PQKGRAHLIQELEQLRERMNIPA-SSGRKSDGMLQTLPLPTAKCYMFHWEKDNFDVLNTLLEHDLDDLAP 314 torafugu
XP_005797615 233 ETAA-MS-D-PGTARSHVIQELERLRKTLKIPS-SNGRMSDGNLQTLPLPTAKTYMFHWEKDNFDVLHTIVDLDVDEFGA 308 southern platyfish
XP_006635512 236 ETAVSVE-D-IDKAREHLLEDLERLREKIGLPA-PNSKKSEGMLQTLSLPIARCHTYHWDKDNFDILNEIFQAECDLAEA 312 spotted gar
XP_001366777 238 ELASAIR-D-PLEARQWLKAKLKAVGERAGFPY-ISETAQSCKLYTIPIPVARCYTCSWNQDSFDILNEILLKERELFQP 314 gray short-tail...
NP_055123    238 ELASGIG-D-AAEARRWLRTKLQAVGEKAGFPG-VLDTAKPGKLHTIPIPVARCYTYSWSQDSFDILQEILLKEQELLQP 314 human
XP_003217124 238 EIAAVSS-DdPSIAREQLESALWEIAKAAELPI-ITDEALPSKLRLIPIPVARCYTYRWDTDNFDILNEVLDKEGYYPKP 315 green anole
NP_001039143 237 ERAAMADiK-PGKTRESLKAKLLEVAEKAGLLGeNTGTNVTCRIQPFAMPVAKCYTYSWDQDDFDILNQVLLSESHLESL 315 western clawed ...
XP_003443226 241 EMAASAA-D-LRSAREGILQSMERLKESLTVPArADEGTDMGAVDIFTLPFPKCHKCHWENDNFDVLKHILGAQNDMDL- 317 Nile tilapia
Q5ZIB8       313 VASeneedEE-EE---------EEDVETDgcsperds-------llspissiSKD---S--VYSA------LSEDgpkhs 364 chicken
XP_005470045 319 NEQ-----EE-EGdi-----ddESDYRNS-----------------------HRA---S--TFST------ISST----- 348 Nile tilapia
XP_011610738 315 NGQldegeEEvDIny-----eeEEDVPETdgegeqeedielpsiipadcgpaHRA---S--TFSTfstissLSTA----- 379 torafugu
XP_005797615 309 SEEaveekED-DSddeq--dgtEDDEEGRevgssl------------vcngsHRVstfS--TISS------TSTT----- 360 southern platyfish
XP_006635512 313 QPQpdegeDD-EEee--------edVEEEevavn--------------gcvdHRA---S--TFST------VSIL----- 353 spotted gar
XP_001366777 315 ETL---------Ede-----eeEEDLEADgcfaerds-------lfstssmaFRD---L--TRST------ASLP----- 357 gray short-tail...
NP_055123    315 GILgddeeEE-EEee-----evEEDLETDghcaerds-------llstsslaSHD---S--TLSL------ASSQ----- 365 human
XP_003217124 316 VLLed--------------------eEADncfse--------------rdslLSE---DgpCNSR------VSIV----- 347 green anole
NP_001039143 316 EDEvteedEE-VDfe-----evDDKEDEDggdsp--------------kqdfAKS---Y--VYWN------FPSD----- 359 western clawed ...
XP_003443226 318 SDCflktgLD-DDdnndtsfdeEDELEGNkdd------------------peFQS---H--RIST------ASSS----- 362 Nile tilapia
Q5ZIB8       365 cvslfssS---KDSISELTVVSKKSLRSFVSS---LKDCMDSG---YAEDSDESSLDTL-G-RPElKVEKThHKYRHTLT 433 chicken
XP_005470045 349 -------S---KDSMFSTLSVASESYAPSLLS---ITSGADSD---YFEDSDDYICSSP-V-TEK-SSPKS-MKSPARLS 408 Nile tilapia
XP_011610738 380 -------S---KDSMFSVLSATSESYALSQFS---TTSGADSD---FFEDSDDCISSSP-V-SEK-CSPKSaNKASARLS 440 torafugu
XP_005797615 361 -------S---KDSMFSTMSLTSESYPPSLFS---VTSGVDSD---YFDDSDDYISSSP-V-AEK-YSPKSs-KVSTRLS 420 southern platyfish
XP_006635512 354 -------StasKDSMLSNNSFSSISSSSSGPSrlsVASGMDSD---FCEDTEEESSTDK-T-P----------KARARLG 411 spotted gar
XP_001366777 358 ---------------ASVPGFSSHLLTSFVSG---LSDCMDSG---YMEDSDESSPDRP-RkAES-QEEQEsQRPRRKL- 413 gray short-tail...
NP_055123    366 ---------------ASGPALSRHLLTSFVSG---LSDGMDSG---YVEDSEESSSEWPwR-RGS-QERRGhRRPGQKF- 421 human
XP_003217124 348 -------S---KDSALSL--VSKKSLKSFVSS---LKDCVDSG---YMEDSDESSPELAgR-LDP-KEEKMsSRHRHRLS 407 green anole
NP_001039143 360 -------S---KEAM-SMSNLSSQSMT-FVSS---LSSCVDSG---YVEDSDEGSQEISeM-GEY-QEERAnSK----LK 415 western clawed ...
XP_003443226 363 -------S---RDSGYSLS------SSWSVPS---GSSGVESGeetTQEDIEERQDSQT-K-PRK-KPKKKsR---SLLG 417 Nile tilapia
Q5ZIB8       434 NKIYKLF-K-SKSQlvlrrdlkd-------------cvdtgslpL-----------------RRAESLCHPQAKPR-IP- 479 chicken
XP_005470045 409 QHFYRLFiK-PKSP------------------------------L-----------------SRAKSLGNTESKDL-FV- 438 Nile tilapia
XP_011610738 441 QHLYRLF-K-PRSPr----------------------------sI-----------------SRAKSLGNPEAKDL-LV- 471 torafugu
XP_005797615 421 QHLHRLFiK-PKNPr----------------------------mL-----------------SRAKSLGNSESKDI-LV- 452 southern platyfish
XP_006635512 412 KRISMLF-K-SKSSn----------------------------sL-----------------NRAKSLGNTEAKDY-VT- 442 spotted gar
XP_001366777 414 NRIYKLL-K-SKSHlvlrrdsqsp----------vkgassvelpL-----------------RRTGSLCSPLNIPS-PPs 463 gray short-tail...
NP_055123    422 IRIYKLF-K-STSQlvlrrdsrsl-----------egssdtalpL-----------------RRAGSLCSPLDEPVsPP- 470 human
XP_003217124 408 NKLYKLF-K-SKSQl----------------------------iLgkelrdisevtslslplRRAESLCNPVAKDR-IP- 455 green anole
NP_001039143 416 QKICRLF-K-TKVHqakgklkaelspcishpllspfpdlsktipL-----------------RRAGSMYTPQ-VSR-IP- 473 western clawed ...
XP_003443226 418 --FSLLF-KpPRSPr----------------------------vC-----------------RRVQSMAYHKDFQR-TQ- 447 Nile tilapia
Q5ZIB8       480 ARSRRAHSLPQHGLGQKLQT-PQTPQLLS----LPRRPFLSYDED---AKVATMRVVVFGSDRISGKVARAYSNLRLKES 551 chicken
XP_005470045 439 VREKRSNSLPQQVRLHSPEPlLQPQSQTLkhvcFRRRPILSSDED---IKNITLRVVVFGADHVAGKVARAYNDLRRKET 515 Nile tilapia
XP_011610738 472 LREKRSNSLPQQVKLLSPEPlLSPQSQTLrhvcYRRRPILSSDED---SKNTTLRVVVFGADHVAGKVARAYSSLRRKES 548 torafugu
XP_005797615 453 VRETRSNSLPQQVKLFSSDSlPRLQNQALqhicFRRRPILSSDED---NKSTTLRVVVFGADHVAGKVARAYSSLRRKES 529 southern platyfish
XP_006635512 443 IRSKRSNSLPQQVHLQSPE------NMFLrnvcYRRRPILSCDED---TKTTTLRVVVFGADQITGKVARAYSNLRLQES 513 spotted gar
XP_001366777 464 SCSQRSHSLPQHMLESQLSSwLHPTATHHr----hRRPFLSGDED---SKASTLRVVVFGSDRISGKVARAYSNLRKLES 536 gray short-tail...
NP_055123    471 SRAQRSRSLPQPKLGTQLPSwLLAPASRPq----RRRPFLSGDED---PKASTLRVVVFGSDRISGKVARAYSNLRRLEN 543 human
XP_003217124 456 ARSRRAQSLPQHVLSATLFQ-NHVPQNTc----VQRRPFLSCDEN---TKVSTLRVVVFGSDRISGKVARAYSHLKSQES 527 green anole
NP_001039143 474 VRSKRSKSLPQHALGTQFLEv-----QLSqkvaFKRRPFLSCDEE---TKVSTLRVVVFGSDRISGKVARAYSNLRLKES 545 western clawed ...
XP_003443226 448 SQLKHSK-----VHPLHESPpPLDPLSPQkhlcVRRRPILSCNEEdlvEAPTLVKVVVFGGDREAGRLARAYSDLHQKES 522 Nile tilapia
Q5ZIB8       552 TCPTLTRYFKLQFFYVPVKRSCLL-P--AaLL--MHPP----PSPSDLQ---L---Ral---aQaepTLAGAESSTNDIS 613 chicken
XP_005470045 516 ACPRLSRAFNLQFYFVPVKKDSAViG--A-RR--GSSPlpqpGASKGTA---L---C------N---DHMGIGDSTNDIA 575 Nile tilapia
XP_011610738 549 ACPRLTRAFNLQFYFVPVKRDPAA-G--L-GGlkSPSPvvqtGTLRGGT---L---S------Nd-lQLTGAGDSTNDIA 611 torafugu
XP_005797615 530 TCPRLTRAFNLQFYFVPVKRDSGF-G--H-RR--SSTPlpqtGSPKGSG---L---S------W----VSSTGDSTNDIA 587 southern platyfish
XP_006635512 514 RCPRLTRLFKLQFFFIPVKRNSSS-P--A-VG--VSSPgslsDSPGRGS---M---AvkscllAqdpSLPCLEDSTNDIA 581 spotted gar
XP_001366777 537 NCPLLTRYFKLQFFYVPVKRSYQP-I--S-GT--SSAPsnqsHLMSTESlrhL---T------PmdiTLSSWEDSTNDIS 601 gray short-tail...
NP_055123    544 NRPLLTRFFKLQFFYVPVKRSHGT-S--P-GA--CPPPrsqtPSPPTDS---PrhaS------PgelGTTPWEESTNDIS 608 human
XP_003217124 528 SCPRLTRYFKMHFYYVPVKRSGPT-S--S-VL--THPP----PSPGNSHsrtP---G------AtvlNLAGMESSTNDIS 588 green anole
NP_001039143 546 SCPLLTRFFKLQFYYVPVKRSSSS-PnaP-LT--NAESplksPSPSGRS---P---L------E---DIFGDEGSTNDIS 606 western clawed ...
XP_003443226 523 KCPQLTKVCKLQFYFVPTKRR-SG-S--P-GG--GHTPteerIGGLTKT---T---T------SadsNGLAVDDCTTDIA 583 Nile tilapia
Q5ZIB8       614 HYIGMLDPWYERNVLGLMNLPMDVLC-QSAKPEAEPQE-DS-REQLPILADMILYYCRFATRPVLLQLYQTELTFIGGEK 690 chicken
XP_005470045 576 HLLGMLDPWYERNTLSLLNLPANIVCqQTSKTESESYD-SSyEQRLPILADLVLYYCRYAARPTLIQLYQAELTLACGER 654 Nile tilapia
XP_011610738 612 HLLGMLDPWYERNTLSLLDLPASIVCqQTSKTESDSYD-DSyEQRLPILADLVLYYCRHASSPTLIQLYQAELSLASGER 690 torafugu
XP_005797615 588 HLLGMLDPWYERNTLSLLKLPTNVVCqQTSKTESASYD-SSyEQRLPILADLVLYYCRYAARPALIQLYQAELMLACGER 666 southern platyfish
XP_006635512 582 QYLGMLDPWYKRNMLSLLNLPVEVLCqQTSKTEPDVSS-ST-RERLPILADMVLYYCRHAARPVLVQLYQAELMLAGGMK 659 spotted gar
XP_001366777 602 HYLGMLDPWYERNVLGLMHLPTDVLCqQTLKTETGPLE-SA-QEQLPILADMLLYYCRFATRPVLLQVYQTELTFISGEK 679 gray short-tail...
NP_055123    609 HYLGMLDPWYERNVLGLMHLPPEVLCqQSLKAEAQALE-GS-PTQLPILADMLLYYCRFAARPVLLQVYQTELTFITGEK 686 human
XP_003217124 589 LYLGMQDPWYERNVLGLMNLPIHVLCqQSIKPEGEPLE-ET-SEQLPILADMILYYCRFATHPVLLQVYQTQLTFTGGET 666 green anole
NP_001039143 607 HYIGILDPWYKRNIMGLMDLSTSMLCqKSSKPENEATE-TT-T--MPILADMVLYYCRFATRSLLLQLYQAEITFDGGGK 682 western clawed ...
XP_003443226 584 HMLGIMDPWYERNVLSLLSLSSDVLSqAASKDDSVSHSnGG-TEQLPLLADLVLYYCRHADQPVLVQLYQVELTLVGGER 662 Nile tilapia
Q5ZIB8       691 MTEVFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAIPLTLQIAYSKTAISGRSQWNDVEKVCTSVNLSKACKKYEEL 770 chicken
XP_005470045 655 RTEVFVHSLELGHAAGTRAIKAMGAASKRFGIDGDREAVPLTLEVVYNKVVISGRSQWKRETKVCTSVNLIKACKNPEEL 734 Nile tilapia
XP_011610738 691 RTEVFIHSLEMGHTAGTRAVKAMGAASKRFGIDGDREAVPLMLEVVYNRVVISGRSHWKKDTKVCTSINLTKACKTPGEL 770 torafugu
XP_005797615 667 RTEVFVHSLELGHTAGTRAIKAMGAASKRFGIDGDREAVPLTLEVVYNRVVVSGRSQWKRETKVCTSMNLIKACKNPEEL 746 southern platyfish
XP_006635512 660 RTEVFIHSLELGHTAGTRAVKASGPVCKRFGIDGDREAVPLTLEIVYNKVSVSGRNQWSKVNKICTSVNLTKACKKPEEL 739 spotted gar
XP_001366777 680 MTEIFIHSLELGHSAAVRAIKASGPGSKRLGIDGDREAIPLTLQIIYSKGAISGRSRWNNLEKVCTSVNLNKACRKLEEL 759 gray short-tail...
NP_055123    687 TTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEEL 766 human
XP_003217124 667 RTEIFIHSLELGHSATTRAIKASGPGCKRLGIDGDREAIPLTLQIAYSKRSVSGRSRWNNTEKVCTSVNLRKACKRQEEL 746 green anole
NP_001039143 683 QTEVFIQCLELGHSAALRAIRASGPGCKRLGIDGDRDAIPFTLQIVYSKSSVSGRSRWSNGEKVCTSVSLRKACTTYQEL 762 western clawed ...
XP_003443226 663 RREVFIQSLELGHTAGTRAVKAMGAASKRFGIDEEREAVPLTLSLAYNKVAISGRSQWINKEIMCTSINLHKQWRTPQQL 742 Nile tilapia
Q5ZIB8       771 ASKTECLNLTMTEVVKRQNSKSKKSFNQ-LSVSQIKVDKVQIIGV--QSSFAVCLDQDEQKILQSVTRCEISVCYRPRDS 847 chicken
XP_005470045 735 DSKMECLQLTMTEVLKRQNGKCKKGYNQqLTVTEVKVDKVQVSGVe-NTTFAVCLDQDEKKILQSVTRCEISVCYKPDSS 813 Nile tilapia
XP_011610738 771 DSKMECLQLTMTEVLKRQNSKSKKGYNQqLNLTEVKVDKVQVSGAg-NTTFAVCLDQDEKKILQSVTRCDISVCYKPDSS 849 torafugu
XP_005797615 747 DSKMECLQLTMTEVLKRQNGKSKKGYNQ-LTMTEVKVDKVQVSGAg-NTTFAVCLDQDEKKILQSVTRCEISVCYKPDSS 824 southern platyfish
XP_006635512 740 DSKMECLQLTMTEVLKRQNSKSKKGYNQqLNTTQVKVDKVQVSGAc-NTTFAVCLDQDERKIFQSVTRCEISVCYKPESG 818 spotted gar
XP_001366777 760 DSNIEALTLTLTEVVKRQNSKSKKSYNQ-ISTSQIKVDKIQIIGSn-NCSFAVCLDQDERKILQSVVRCEVSPCYKSENN 837 gray short-tail...
NP_055123    767 DSSMEALTLNLTEVVKRQNSKSKKGFNQ-ISTSQIKVDKVQIIGSn-SCPFAVCLDQDERKILQSVVRCEVSPCYKPEKS 844 human
XP_003217124 747 GPKTECLTLTATEVIKRQSSKSKKSFNQ-ISVSQIKVDKIQIIGV--NCSFAVCLDQDERKIMQSVVRCEVSACYKPKIS 823 green anole
NP_001039143 763 DSKTECLNLTVREVVKRQNSKTKKSFNQ-ICTSHIKIDKAQIIAQh-GGTFPLCLDQDERKILQRVIKCEVSPCYKPEGR 840 western clawed ...
XP_003443226 743 DS-AESLQLTMTEVLKRQCSKSKKGYKQhISVSEVKVDKMQVNGRdpGTTFAVCLDQDEKKFIQSVTRCEVSPCCKPGSG 821 Nile tilapia
Q5ZIB8       848 DPLALRR--SSLTPQD-PSEFHSLLCLPISTFSGALP 881 chicken
XP_005470045 814 TDWRLRKfqASAQIQPlHPTFCSLLCLPIVTFSGALP 850 Nile tilapia
XP_011610738 850 TDWRLRRsqTSAQIQPlNPTFCSLLCLPIFTFSGALP 886 torafugu
XP_005797615 825 TDWRLRKsqASAQIQPlNPTFCSLLCLPIVTFSGALP 861 southern platyfish
XP_006635512 819 MHWRIRKalSS---QPlCPEFCSLLCLPISTFSGAhs 852 spotted gar
XP_001366777 838 SLCPQPQrlSFLPPQn-SPDLCSFLCLPIMTFSGALP 873 gray short-tailed opossum
NP_055123    845 DLSSPPQtpPDLPAQA-APDLCSLLCLPIMTFSGALP 880 human
XP_003217124 824 KSSIGGKvmPSFPPQE-PSDFCSLLCLPIATFSGALP 859 green anole
NP_001039143 841 DFCRRNRppSWSQASQnQSEFCSLLCLPIATFSGAQP 877 western clawed frog
XP_003443226 822 LDWRTYKplL-GQVQPlHPSYCSMLCLPITSFSSSYP 857 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap