Conserved Protein Domain Family
ParA

?
pfam10609: ParA (this model, PSSM-Id:287566 is obsolete and has been replaced by 402307)
NUBPL iron-transfer P-loop NTPase
This family contains ATPases involved in plasmid partitioning. It also contains the cytosolic Fe-S cluster assembling factor NBP35 which is required for biogenesis and export of both ribosomal subunits.
Statistics
?
PSSM-Id: 287566
Aligned: 165 rows
Threshold Bit Score: 286.264
Threshold Setting Gi: 74621068
Created: 26-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2G304        73 ARVIIAVGSGKGGVGKSTVSANLAVAMARLGRKVGLVDADIYGPSQPRLLMTEGRRP------EAEgnK--MI-PIDsP- 142 Novosphingobium...
Q24WB3        35 IKNVIAVMSGKGGVGKSSVTSMLAVSLMRQGFKVGILDADITGPSIPRIFGLRD-KA------NMN--EvgVI-PGE-Ts 103 Desulfitobacter...
Q97EX4        29 IKNIIGVISGKGGVGKSTVTGILAVKLRKKGYKVGVLDGDITGPSMPRILGISDKRSliv-qkKGS--EdvKFvPVE-Tk 104 Clostridium ace...
Q24RW5        36 VKKVIGIVSGKGGVGKSLVTSMLAVSMKKRGYHTAILDADVTGPSIPKAFGLK-EKA------RGG--EsgLI-PVK-Se 104 Desulfitobacter...
WP_011915833  17 VKKIYAIVSGKGGVGKSLVTSLLAVGLRREGFDVGVFDADITGPSIPKIFGVTGEKI------DSD--SkaIY-PVR-Th 86  Caldicellulosir...
WP_021944295  35 IKHIIAVISGKGGVGKSSVTTSLAVTLNRLGYKTAVLDADITGPSIPTAFGINEE-P------ERG--DdfLY-AVE-Tk 103 Clostridium sp....
WP_012031758  54 VKNVIAVMSGKGGVGKSSVTSLLACGFRKKGFEVGVLDADITGPSLPRMFGVKG-LL------EAT--PfgLL-PSE-Ss 122 Pelotomaculum t...
WP_033050472  29 AKNIIGVISGKGGVGKSTITGILATKLREEGYKVGVLDGDITGPSMPRFFGISDKRAtiiptgENE--EvkII-PVE-Tk 104 Clostridium bot...
WP_017209521  33 IKNVIGIISGKGGVGKSTVTGMMASMLSKKGYKVGVLDADITGPSMPRFFGVNNKRAkii--plEN--DmvKFePVE-Te 107 Clostridium
BAH05602      53 VKKIIGVMSGKGGVGKSSISVLIARHLKEMGYSVGILDADVTGPSIPNLMGLRGKKA------ETN--EefIL-PVE-Tq 122 Clostridium klu...
Q2G304       143 YGVPMLSMGHLVQ-PGQAIAWRGPMAGNALGQLI-DAHWGETEIIVVDLPPGTGDVQLTMLQKHKPAGAVIVSTPQDLAL 220 Novosphingobium...
Q24WB3       104 HRIKVMSLNLMIPnEDDPVIWRGSIITQLVQQFWtDVVWGELDYLLIDLPPGTGDVPITVMQSLPVSGVVIVTSPQQLAG 183 Desulfitobacter...
Q97EX4       105 QGIKVISLNLMIEsEDQPVIWRGPVVNNVLNQMYtDTEWGELDYLIIDMPPGTGDVALTVMQNIPLSGMIIVSTPQDMVS 184 Clostridium ace...
Q24RW5       105 AGIDIMSINLLLPkDTDPVIWRGPIIAGIVKQFWtDAIWRDVDFMFIDMPPGTGDVPLTVFQSLPVDGIIVVTSPQELVA 184 Desulfitobacter...
WP_011915833  87 NDIRIMSMNLLLNkEDAPVIWRGPLIAKTIEQFWtEVGWGVLDYLLIDMPPGTGDVVLTVFQSIPIDGIIIVTSPQDLVS 166 Caldicellulosir...
WP_021944295 104 TGIKMMSINLLIEdQTAPIIWRGPIIAGAVKQFYtDVVWGDIDYMLVDCPPGTGDVPLTVFQSLPVDGAVIVTTPQDLVS 183 Clostridium sp....
WP_012031758 123 TGIKVMSMNLLMHdEDEPVIWRGPVLSNTVKQFWtEVVWDYLDYLFVDLPPGTGDVPLTVMQSLPLNGLIVVTSPQDLAA 202 Pelotomaculum t...
WP_033050472 105 TGIKVMSLNLLTEqEEAPVIWRGPVITGVLTQMYtDTEWGELDYLLIDMPPGTGDIALTVMQSLPVTNMVVVSTPQDMVS 184 Clostridium bot...
WP_017209521 108 SGIKIISMNLLTAvEDEPVIWRGPVITGVLKQMFvETNWEELDYLLIDMPPGTGDIALTVMQEFPIDEIVIVSTPQDMVS 187 Clostridium
BAH05602     123 SGIKTISLNLLLQdENQPVIWRGPLISGAVKQFWtDVIWGELDYLVIDMPPGTADVALTVMQSIPISGLVMVSIPQELVS 202 Clostridium klu...
Q2G304       221 MDATRAIGLFEQGQVPIVGMVENMAGYICPHCGEESDPFGVGGAEAAAKTMGLPFLGRVPLDMAIRRESDAGNPPAAGd- 299 Novosphingobium...
Q24WB3       184 MIVRKAINMVKKYDATIYGLVENMAYVACPQCEERIEIFGKPHGEAEAAQNEIPYLGQLPIDPVLATMSDLGK------- 256 Desulfitobacter...
Q97EX4       185 MIVKKVVTMAQKMKVNMLGVVENMSYIVCNKCGDKMRVFSKKSAKEQSEYLGLPLICEMPIDLDLVENLENGT------- 257 Clostridium ace...
Q24RW5       185 MIVTKAVNMAKVMNIPVLGLVENMSYFKCPDNGKEYRIFGESHIEEIAAEHQLKILAKLPIEPQIAAACDQGA------- 257 Desulfitobacter...
WP_011915833 167 LIVKKAYNMAKQMDIPIVGIVENMSYAICPHCGKEIEIFGKSKLESIAQELDLKILGKVPIDPELTKLCDEGE------- 239 Caldicellulosir...
WP_021944295 184 LIVEKAVRMADDMGIRILGLVENMSYFKCPDCGKEHSIFGESKVEEIQDRFGIETVVKLPIDPALAGLMDEGK--IEDmp 261 Clostridium sp....
WP_012031758 203 MIVKKAVKMANLMNIPIMGLIENMSGAVCPKCGEEFQLFGPGHGREVAEKFNLRFLGSLPVDPELSVLCDEGK------- 275 Pelotomaculum t...
WP_033050472 185 MIVKKVVIMIEKMGIEVLGVVENMSYIKCGSCGEKLNVFSKKSAEEQAEYLNIPLIADMPINLDLSEEMEKGEVETFIin 264 Clostridium bot...
WP_017209521 188 MIVKKVVIMAQKIGVKIKGVVENMAYINCPDCDKKIRVFSRKSSEENAEYLGIPLIGELPINIELTEALEQGK------- 260 Clostridium
BAH05602     203 MIVSKAVNMAKAMNISILGVIENMSYITCPDCGKKIKFFNGKNTEKFLKEMNLKFLGELPMLSSVSNLSEQGS------- 275 Clostridium klu...
Q2G304       300 -GP----QAEAFLSIARGV 313 Novosphingobium aromaticivorans DSM 12444
Q24WB3       257 -IEd--yESAGFTQIAKNL 272 Desulfitobacterium hafniense Y51
Q97EX4       258 -AEeyiyNSSEYDEILNDV 275 Clostridium acetobutylicum
Q24RW5       258 -IEq---VEEHWFDLAAEL 272 Desulfitobacterium hafniense Y51
WP_011915833 240 -------IEKARNLYLDSC 251 Caldicellulosiruptor saccharolyticus
WP_021944295 262 eSK----LKEFAQTIvgki 276 Clostridium sp. CAG:264
WP_012031758 276 -------IEDYKSDIFTNV 287 Pelotomaculum thermopropionicum
WP_033050472 265 nEE----YAQLYnnfknyi 279 Clostridium botulinum
WP_017209521 261 -AEeyvkENPLYSLIFEGL 278 Clostridium
BAH05602     276 -ESidesLKKIFNPIVTNI 293 Clostridium kluyveri NBRC 12016
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap