Conserved Protein Domain Family
Sterol-sensing

?
pfam12349: Sterol-sensing (this model, PSSM-Id:289145 is obsolete and has been replaced by 403533)
Sterol-sensing domain of SREBP cleavage-activation
Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.
Statistics
?
PSSM-Id: 289145
View PSSM: pfam12349
Aligned: 30 rows
Threshold Bit Score: 149.645
Threshold Setting Gi: 74675993
Created: 26-Jun-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O16307        208 VFSHNVVMAILGIAGPLMATGTAFGFLFLFGFPFNSITL-VMPFLIIGVGCDDVFIIIHAMRKTDKSESLEDRIAETMEE 286  Caenorhabditi...
Q17N28        360 VIRSRLVLAFSAVLTVLGSLTMSLGMCFFFGLTISLQSKgVYPYLVILVGLENVLVITKSVLTTDSNLDVKIRLAQGLSR 439  yellow fever ...
Q18968        295 MVASRWGLAFASSFTVASTLLMTTGICAHLDLSTTTWGSeVYPYIALIMGLENTLCITRSVVYTSPSLDVSSRIAHGLSQ 374  Caenorhabditi...
Q4PBD7        410 KVHSRFGLAFTGTTQLIISMIMSVSICALLGIRLTLVPWeLLPFVIVVVGSENMYSLTKAIVDTPLSLTVSSRIAHGLGK 489  Ustilago maydis
O43043        257 DIRAKFGLTATIFIQSGTAYFSTCSLLYFFERTGPICPWpMAYYIIIFMDIENSFRLLRAVIASPQTKRVPSRIMEGFSS 336  Schizosacchar...
Q2HB50        263 AVKSRVGLMVTMLAQITASIVSSFTVCAIFKVDLSHVPLqTYPFVILAISMENSFRLINAVIMTSSAISISDRIGEAFGT 342  Chaetomium gl...
Q19945        297 WISSKPWLAAAGMFSTVLSIISAFGFLFILGVRYNVINT-IIPFLIIAIGIDDMFLMNACWDQTSKSLSVPERMSKTLSH 375  Caenorhabditi...
XP_001641016  240 MVKSKWGLAFSAVITVIASLIMAAGLCTMFGLVPTLNSSeIFPYLVIMIGVENILVITKSVVSTPVDLDVKHRVAQGLSK 319  starlet sea a...
AAH27207        1 MVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGeIFPYLVVVIGLENVLVLTKSVVSTPVDLEVKLRIAQGLSS 80   human
XP_002043388  385 VFRSRFLLALCSVITTAGSLAMSLGLCFFFGLTISLQSKdIFPYLVILVGLENSLVITKSVVSMDETFDVKIRVAQALSK 464  Drosophila se...
O16307        287 AGPSITVTSATNCLSFA-IGIATPTPAISLFCLYTCVAVAVDFVYQLTFFVAVLVYEEKRL-MKL-QKVGEEKKI 358  Caenorhabditis ele...
Q17N28        440 EGWSITKNLLTEITILT-IGLCTFVPVIQEFCIFAIVGLVSDFFLQMMIFSTVLALNIKQVeYSAeVRQLPKMLY 513  yellow fever mosquito
Q18968        375 EGYKLTKYYILELLALL-IGFLTRISDIQEFCQFSVICVTVDFYMQLFFYAPCLTFDLQRLgLEEkRKFAEILLY 448  Caenorhabditis ele...
Q4PBD7        490 VGVPITLTTLADILLLLvIALFIEVRAVREFCIFAIFSLIMDWFLQMTFFVTVLSIDMQRLeLADlLTQGTRLSR 564  Ustilago maydis
O43043        337 TIIASFSSLLKKLLTLFvLS-FFVYPLVQEFCLFLACSFVVSFLLHGSFFLAVLSVDIRRLeLQDfLDSNSSNRN 410  Schizosaccharomyce...
Q2HB50        343 TAHIAIASPIQNSLILYgLS-KTGSLGVSSFCAFATIATFFDFFYLATFFLAVLSVDVRQReLCE-LEKASLKRA 415  Chaetomium globosu...
Q19945        376 AGVAVTITNVTDVMSFA-IGCITDLPGIQFFCIYACVSVAFSYFYQLTFFSGAMAIMGEVE-REKrHCLFFYRTF 448  Caenorhabditis ele...
XP_001641016  320 EGKYMLKNLLWEILVLG-LGYLTYVHAIQEFALFALVGLLTDFFLQVFMFATILSIDIRRMeGILlRQRGRLHSS 393  starlet sea anemone
AAH27207       81 ESWSIMKNMATELGIIL-IGYFTLVPAIQEFCLFAVVGLVSDFFLQMLFFTTVLSIDIRRMeLADlNKrlppeac 154  human
XP_002043388  465 EGWHISKTLLTEITILT-IGLATFVPVIQEFCIFAIVGLLSDFMLQMLLFSTILAMNIKRTeYTAeAKHLPKMLL 538  Drosophila sechellia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap