Conserved Protein Domain Family
Ig_J_chain

?
pfam15097: Ig_J_chain (this model, PSSM-Id:291756 is obsolete and has been replaced by 405738)
Immunoglobulin J chain
Statistics
?
PSSM-Id: 291756
View PSSM: pfam15097
Aligned: 12 rows
Threshold Bit Score: 164.941
Threshold Setting Gi: 119607525
Created: 24-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P01592        23 DDEATILADNKCMCTRVTSRIIPSTEDPNEDIVERNIRIVVPLNNRENISDPTSPLRRNFVYHLSDVCKKCDPVEVELED 102 house mouse
P23108         1 EDESTVLVDNKCQCVRITSRIIRDPDNPSEDIVERNIRIIVPLNTRENISDPTSPLRTEFKYNLANLCKKCDPTEIELDN 80  rabbit
Q3SYR8        24 DENERIVVDNKCKCARITSRIIPSAEDPSQDIVERNVRIIVPLNSRENISDPTSPMRTKFVYHLSDLCKKCDTTEVELED 103 cattle
XP_011223657  25 EDGRTVLVDNKCQCARITSRIIPSPEDPNEDIVERNIRIIVPLNNRENISDPTSPVRTKFVYHLSDLCKKCDPVEVELGN 104 giant panda
XP_006094475  25 EDERTVLADNKCKCARVTSRVIPSPDDPTQEIVERNIRIIVPVNNRENISDPTSPLRTKFVYHLSEMCKKCDTTQVELEN 104 little brown bat
NP_001265705  25 EEERTVLADNKCQCARVTSRVIRNPDNPVEDIVERHIRIIVPLNSRENISDPTSPLRTKFVYHLSDLCKKCDPVEVELDD 104 domestic guinea...
NP_989594     26 DGEERVLVNNKCKCVTVTSKFVPSKDNPEEEVLERNIRIIVPLKSRENISDPTSPLRTTFVYRMTELCKKCDPVEIELGG 105 chicken
XP_003341415  29 EDEGRILVDNKCKCVRVTSRLVPSKDNPEEKVVERNIRLIVPLRNRENISDPTSPVRTRFVYRLSDLCKKCDPTELELNN 108 gray short-tail...
NP_001296431  28 QDEEYVLVNNKCQCVTVTSKFVPSKEDPEEEVLERNIRIIVPLKARENISDPLSPPRTTFVYRLSELCRNCEPVEIDLGG 107 zebra finch
XP_003430954  27 gddgdvlvdNKCKCTRVTSKFVPSKEDPSVKVLERNIRVIIPLKARQNISDPTSPPRTRFVYELSKLCQKCDQTEVELDH 106 platypus
XP_003221879  67 hDQEKVLVDNKCQCVKVTSKFVASKDDPDNEVLVRNIRIVVPLTARENISDPTSPVRTKFVYKLSKLCDNCHSSGNPENG 146 green anole
EAW87119       1 -------------------------KEPNDGIVERNIQIAVLLDNKKNISDPISRLRTKFVYHLSYLCKKCDPT------ 49  human
P01592       103 QVVTATQSNICnedDGVPETCYMYDRNKCYTTMVPLRYHGETKMVQAALTPDSCYPD 159 house mouse
P23108        81 QVFTASQSNICp-dDDYSETCYTYDRNKCYTTLVPITHRGGTRMVKATLTPDSCYPD 136 rabbit
Q3SYR8       104 QVVTASQSNIC---DSDAETCYTYDRNKCYTNRVKLSYRGQTKMVETALTPDSCYPD 157 cattle
XP_011223657 105 QIVIASQSNLC---DEDSETCYTYDRNKCYTNRVPFTYGGQTRMVETALTPDSCYPD 158 giant panda
XP_006094475 105 QVVTATQSNIC---DEDNETCYTYDRNKCYTNKVPFSYGGKTVMVETALTPESCYPD 158 little brown bat
NP_001265705 105 QVVTATQSNLCe-dDREPETCYTYDRNKCYTNVVPLSYGGKTKLVTAALTPDSCYPD 160 domestic guinea pig
NP_989594    106 ETYQAQQSNSC---N-EPETCYTYNRDKCYTTTFPFVYHGETKHIQAALTPTSCYAE 158 chicken
XP_003341415 109 EVVTATQSNNC---DDTSETCYTYDRNKCYTSTAALYLEGETRLVTTALTPESCYND 162 gray short-tailed opossum
NP_001296431 108 VIYHAQQGNSC----EEPQTCYTYDRNECYSSPVPLLYHGEVRQVPAALTPASCFTE 160 zebra finch
XP_003430954 107 EVVTATRGNSC---DRPGDDCYTYDRNKCYMSTIPFTYGGETKVVNTVLTPESCYPD 160 platypus
XP_003221879 147 QRV--GESGLC---NDPQEPCYTYDRNKCYTAPCLFNNAGKTETIETALTPESCYDD 198 green anole
EAW87119      50 ------ESNIRd-eDSATEICHTDVRNKCYTTMVLLIYGGETKMVKIGLTPGSCYPD 99  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap