Conserved Protein Domain Family
DUF4659

?
pfam15558: DUF4659 (this model, PSSM-Id:292195 is obsolete and has been replaced by 406094)
Domain of unknown function (DUF4659)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 427 and 674 amino acids in length. There are two completely conserved residues (D and I) that may be functionally important.
Statistics
?
PSSM-Id: 292195
View PSSM: pfam15558
Aligned: 32 rows
Threshold Bit Score: 221.765
Threshold Setting Gi: 597732978
Created: 24-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERE72454     242 EISSRDQKILALVLSRLKKAQKMRELQQQAAVAWEELKRSDKKVHMTLERERRLLLQQSQEQWQgQKEQHKSRRDHEQLR 321 Chinese hamster
ETE72516     297 EVSDRDRKIAALMIAKHQEESLWKEQRYSAHLQWDVQRRVAEQRREREEREKQQALLQGRRMWEtRLEKRRGRLTHTWEE 376 king cobra
XP_006011788 266 EVPERDRKIAALMLAKHQEENILSEQRHMAYLQWDSERKRNELRKEREEREKQRALLQCHKMWEsRVEKRRWKMTQEKRD 345 coelacanth
XP_003756429 342 GLPERDRKIAALMLARHQEEELLREQQAFAHSQWELQRKKTMQQREKEEKEKQRVLAQCRQAWTaQVEERLGRLGHQERK 421 Tasmanian devil
XP_002199374 223 EVPERDKKIAALMIAKHQEASLLREQRQAAHLQWDSQRRLAEQRKEREEKEKQRALLQGQRMWEsQVEKRRGRLNQEQEE 302 zebra finch
XP_007473174 331 GLPERDRKIAALMLARHQEEELLREQQALAHGQWELQRTEAMKQREKEEKEKQRALMKCHQVWVaQVEDRLDKLDREERR 410 gray short-tail...
XP_008116349 328 EVPERDRKIAALMIAKRQEESLLSAQRYSAHLQWDTQRRRAEQRKEQEEREKHRALVQGQRMWEsRLEKHRRRRSSEQEE 407 green anole
XP_002935376 318 ELPQRDKKIAAIMIAKHQEENIRKEQRYLAHIQWDIQRKNSELRKEQEEKERQKALLHGQRSWErHMKSRENRNSVGEMS 397 western clawed ...
XP_005623633 331 GVPDRDRKIAALMLARHQEERLLLEQRAAAHGQWEQQRVRAEQRREREEREKQRALEQGRRAWAaQVEERRGRRGREERE 410 dog
XP_002111183 227 GVPEKDRKIIELMLNRHREEEESDRVRRLANLNWEQQRLALDEKMAMNLNRKKEEIRESNRARLaAQEQQKAKVDYENEV 306 Trichoplax adha...
ERE72454     322 qgyeqqgeRRDRQEKSTIqaqaESQSRWPEQPDNPENGDLDKLDRVHAQAEHLKQCQMQRLQEQERVLQSLRDLNRLQMQ 401 Chinese hamster
ETE72516     377 --------AVQMKQRQTL----VEDEKWREHLEKQERLKRERLEKAALEDKKRKRHQEHNLKAQEANKKEVQVREVQLLQ 444 king cobra
XP_006011788 346 --------TASFKQQQTM----TQEEKWREQAEKQERARKEKLEKARQEEQQKKLHQEQNLKIKEEEKKVTLEQEGQMLQ 413 coelacanth
XP_003756429 422 --------AARRLRSQYA----RGEEQRLELLERQGQLRLERAQRAAFEDRMRKLQQEHNLKLWEEGRQKERERVDYARR 489 Tasmanian devil
XP_002199374 303 --------AALMRQKQLL----VCEERWREQAEKQERLRRERLERAIKEDKQKKLHQELNLKAKEEVKKEHQEREEQLLQ 370 zebra finch
XP_007473174 411 --------AARRLRRRFA----QGEEQRLEHVERQSQLRLERAQRVALEDKMRKLQQEHNLKLWEEGRQKERERVSHARR 478 gray short-tail...
XP_008116349 408 --------AALQKQRQSL----MVEEKWQAHLERQEGLRKAKLEKAAQEDKRKKRHQEHNLKAQEEGKKEAVEREVQLLQ 475 green anole
XP_002935376 398 --------TASLTQSKSP----LLEEKGKDQVQELEKIKGEKLANTQTVKQK-------------KSKEEKKEQEGGLFQ 452 western clawed ...
XP_005623633 411 --------EARRRQRQCE----RSEERRRELAERQGLLRRERVERAAREDRLRKLQQEQNLKQREEGLQEGRERAELARR 478 dog
XP_002111183 307 --------QRKFKIEKIQ----EKDAKLAAITSAKQKLLEQQIQLKILQDQSKKKNQEYNLKVEEEYRNAKAIQNHLRNL 374 Trichoplax adha...
ERE72454     402 KKLEVTCHKRQQHlPEESQKKVPENNLSSsIINFQARKVLMDCQAKAEELLRKLSLEQSSQSSQDVQEDLAKERHREQQG 481 Chinese hamster
ETE72516     445 EKLTLAAQKKLVK-EQLIQKEKKLLNQAD-KQKHEAILKGLAKQEAEERAVLRAAMEGSLSKAQENYEQLIEKRNQELRE 522 king cobra
XP_006011788 414 EKLTSAEQKKLER-ELQQQQERKSLSKAD-QLKHQALLKELAKQTQMEKKMLRKSLEQNLSKAQENYEQLVEKRNQELKE 491 coelacanth
XP_003756429 490 ERAEIAAQTKRKQ-DTHLQREKQQLSRAE-RAHHEALLQGLARKERKEQEGLRLSLEASLERAQENYEQLMEQRSRHLRE 567 Tasmanian devil
XP_002199374 371 EKLSTAAQKRLKK-EVQLQKEKRLFNQAE-KLKHEALLKELAKQEAEEKEMLKASLKMSLTKAQENYEQLVEKRNQELRE 448 zebra finch
XP_007473174 479 ERAERAAPTKRRQ-DIYILREKQHLSRAE-RVHHEALLLVLVRKERKENEGLXMSLEAYLGRAQENYELMLAQRSRXIAR 556 gray short-tail...
XP_008116349 476 DKLTLAAQKKLRK-EQLLQKEKQLLNQAE-KRKHEAILKELAKQEVEEKAMLRASVEGSLNKAQENYEQLVERRNRELRE 553 green anole
XP_002935376 453 DKLLVAQHKKKEN-EEQLHISKSLQNKAE-KMKHQAMAQELTQKKEYETEELRKTLQKNLQKAQENVEQLLEKRNQELKE 530 western clawed ...
XP_005623633 479 ERAQRAARTKQRQ-EGQLQREKRELSRAE-RARHEALLQGRARQERAEREGLRSSLEASLGRAQENYEQLVEQRARELRE 556 dog
XP_002111183 375 RIEENARINRQIR-SREDQLRIGANNLKS-ELEHDKKKYDNEMKTREDQHYLQNSIELKHLRADTNYKRQQQIKAEEMRA 452 Trichoplax adha...
ERE72454     482 KAQKEAEQFQRVRWRTEEAEERRRQERQrVLAELAEQKIRQARCHEHKTSKDRVQHLQELSVLRERNNHILKLKAEKEEK 561 Chinese hamster
ETE72516     523 RAKREDLQIQRAKLAAERKDREQKEHLR-ALAQASERKLQHAAQVAEEVVQQKARKVVQNRLEKEKMQKVNKRKVEECED 601 king cobra
XP_006011788 492 RAKKEELQIQRARLAAEKKEREHREHLE-ALAKLAEKKLQHAAQVAEETAQQKARRAVQSRLEKEKLQRLNKQKVEQDEN 570 coelacanth
XP_003756429 568 RARKEELQGRRAKEVAERKGREHQEHLE-ALAKAGEQRMQHATQVVSEAVQLKARRIGQSRLEKERAQRANKEKVDRAED 646 Tasmanian devil
XP_002199374 449 KARREDMQIQRAKLAAEKKEKEQKEHLE-ALARETERKLQHAAQVAEEAVQEKARKVVLSRLEKEKVQKMNKQKVEQYED 527 zebra finch
XP_007473174 557 EARREELQSRRAKELAERKDKEHQQHLE-ALARVGEMRMQHATQVASEAVQLKARRVGQSRLEKERTQRANKEKVDREKD 635 gray short-tail...
XP_008116349 554 RAKREDQQIQRAKLAAEKREKEQKEHLK-ALAKVSERKLQHATQVAEEVVQQKARKVVQSRLEKEKVQKVNKKKVEQCED 632 green anole
XP_002935376 531 RARKEELQILRAKQAAEKQEQGRQEHLQ-KLAIVAEKRLQHAAQVAEEVVQHKARKAIECRLEKERIQRENRQRVQKNED 609 western clawed ...
XP_005623633 557 RARREELQGRRAKEVAERKEREHQAHLE-ALARAGERRLQHAMQAAEEAVQQKARRVGQSRLEKERAQRANKEKVERDED 635 dog
XP_002111183 453 EIMKMQKQFRKQQETAKLMTEEHDEWLK-HLQLEEDLKLEKAETIAALVKEEKRFRAKEQREARQAGQKLNMKKIKKQEE 531 Trichoplax adha...
ERE72454     562 CHIEGIKEAIKKKEQRVEQMTRWKDPIFQEFQKVPSASktDR----------CFDYVAAETQLPAHHLS 620 Chinese hamster
ETE72516     602 IRRREILLSIEKKLERSEQICKEKKTVLESAKSVARASfhVRekvreemnmrTFDKMAFEAELQATLVK 670 king cobra
XP_006011788 571 FRRKELLMSIEKKLERSEQIFKEKKTVLENARSIARASfhVRekvreetnvrTFNKMALEAELHANLDK 639 coelacanth
XP_003756429 647 SRRRELQQAIERKWERSERLSRERRSALENARSTARASfhVRekvreeintrTFDRMALEAKLHANLGK 715 Tasmanian devil
XP_002199374 528 LRRREILLSIERKLERSEQIFKEKKTVLENARSVARASfhVRekvreetnmrTFDKMAFEAELHAQLSK 596 zebra finch
XP_007473174 636 SRRRELQQAIERKSERTERLSRERRSALENARSSARASfhVRekvreetktrTFDRMVMEAKLHASLGR 704 gray short-tailed opossum
XP_008116349 633 IRRRELLLSIEKKLERSEQICKEKKNILENARSVARASfhVRekvreemnirTFDKMAFEAEMQATLVK 701 green anole
XP_002935376 610 MKRKELLESIEKKLERSDHIFRERQTVLDNARSVARASfnIRekvraetntrTFDKMAFEAELYANINK 678 western clawed frog
XP_005623633 636 CRRRELLQAIGRKLERSEQLSRERRSALESARSTARASfhVRekvreetntrSFDRMVRDAQLHASLDR 704 dog
XP_002111183 532 LKQRYTTAQAMSKDRKRQQIAAAKEENLSKLRDTARATslMRykvkemtaksSIGILleslgtdqhhnl 600 Trichoplax adhaerens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap