Conserved Protein Domain Family
RAD51_interact

?
pfam15696: RAD51_interact (this model, PSSM-Id:292324 is obsolete and has been replaced by 406187)
RAD51 interacting motif
This motif interacts with RAD51.
Statistics
?
PSSM-Id: 292324
Aligned: 23 rows
Threshold Bit Score: 49.2717
Threshold Setting Gi: 565300100
Created: 1-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8C551        293 GSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSA 331  house mouse
Q1L8M2        306 GMVGRSPGASQNGSLKSPGQGLRLGLSRLARVKPLHPNV 344  zebrafish
XP_003734836 1106 RGSYFPHGISRVRPLKTCSRPIRIGLSRKARVKQLHPYL 1144 white-tufted-ear marmoset
XP_006225792 1042 GGSHVSHGISRVQPLKTCSRPIRVGLSRRARLKQLHPYL 1080 Norway rat
XP_004007263 1114 AGSSFSYGISRVLPLKTCGRPIRIGLSRKAKLKQLHPYL 1152 sheep
XP_005482933  237 APSGSSNASVKCVPVKSPTHCLRLGLSRLARVKPLHPSA 275  white-throated sparrow
XP_003429896 1172 eGSLLSNGIVRLYPLKTCSGPIRIGLSRRAKAKQLHPYL 1210 platypus
XP_004912815  266 APVGSVKHSLEGVTVKSPSQGLRLGLSRLARIKPLHPai 304  western clawed frog
XP_005740926  270 AQIGKSPSTSQSPAVKSPGQGLRLGLSRLVRVKPLHPSV 308  Pundamilia nyererei
XP_007540540  274 AQVGKSPTSSQTPAVKSPSAGLRLGLSRMVRVKPLHPSV 312  Amazon molly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap