1JHN


Conserved Protein Domain Family
Calreticulin

?
pfam00262: Calreticulin (this model, PSSM-Id:306718 is obsolete and has been replaced by 395201)
Click on image for an interactive view with Cn3D
Calreticulin family
Statistics
?
PSSM-Id: 306718
View PSSM: pfam00262
Aligned: 113 rows
Threshold Bit Score: 443.52
Threshold Setting Gi: 123479232
Created: 12-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JHN_A        28 FADSF----Drg----tL-SGW--------ILSK----AKkdd--tddEIAKYDGKWEVDEMKETk------------LP 72  dog
Q6CET3        48 FFEQFl---Dg--------HKW--------QKSS----AMk------dDEFSYVGEWAVEEPYVFp-----------gFK 87  Yarrowia lipoly...
XP_013933562  36 FFEQF----Ne-----tWaSRW--------KPSH----SKrd------dnFVYRGEWDVEEPTVNp-----------gLK 77  Ogataea parapol...
XP_002491218  37 FFEQF----Dke---pkLgDTW--------KISH----AVk------nEEFTYVGEWAIEEPVVYp-----------gFK 80  Komagataella pa...
XP_002495681  43 LWEDF----QnytstdeLlQKW--------RVSRmalrDAkt----gdTRLMYPATWSLQEPYSLk-----------sFK 95  Zygosaccharomyc...
XP_004177745  40 FWEDF----QryqnindLeQVW--------IRSE----SQvse---gsGERQFPAKWSLEEPTVNp-----------gFR 89  Tetrapisispora ...
XP_003683274  36 FWEDF----QtyndkrpLeESW--------IVSE----SLgqdpstgeSTRRYKGEWDVQEPYNLk-----------aLK 88  Torulaspora del...
XP_001643616  46 FWEHF----QnydtneeFtKTW--------ITSErqviDRss----geERLQYPVKWGIEEAYLVp-----------gLS 98  Vanderwaltozyma...
XP_003686945  47 FFEDF----Qgy----dSeKAFrkkwisskKKIN----DRys----deLVEQYPVKWGLEEAYIVp-----------gFV 99  Tetrapisispora ...
XP_004181242  19 FFENFknykNne----eLyDNW--------ISSN----VTqtq---ftSNLKYPIAWSLLEPYKLsnfetlpdineplLE 79  Tetrapisispora ...
1JHN_A        73 GDKGLVLMSRAKHHAISAKLNKPFLF-D-T-KpLIVQYEVNFQN-GIECGGAYVKLLSKTPE-L---NLDQF----H--D 138 dog
Q6CET3        88 GDKGLVVKSPAAHHAITTAFDTPINN-K-GkT-LVVQYEVKLQK-GLECGGAYVKLLSAEVN-AddkGVEEF----S--S 156 Yarrowia lipoly...
XP_013933562  78 GDKGLVAKTEAAHHAISARLPTPFDN-T-N-NtLVLQYEVKLQK-GLECGGAYIKLLSQEGGvS---DSVEF----S--N 144 Ogataea parapol...
XP_002491218  81 KDRGLVVKSEAAHHAISAQLPQVFDN-T-D-NtLVLQYEVKLQQ-GLNCGGAYVKLLSAE-G-L---NKNEF----S--N 145 Komagataella pa...
XP_002495681  96 NDNCLNLETAHSAAMIGHALANPLEV-A-NgNkLVVQYEVQLQR-GLECGGAFMKLLPPMNG-T---ELLRY----S--G 162 Zygosaccharomyc...
XP_004177745  90 GDKGLVLKDKDTFAMIGRIFERPIELeK-D-SkLVVQYEVKSQNiNSDCGGAFLKLYSPVQE-Q---EFKDF----G--N 157 Tetrapisispora ...
XP_003683274  89 GDRALTLKNSGVAAMIGRVLPQPIEC-TaD-SdLVVQYEVQLQN-DLKCGGAFVKLLPEVSP-S---ELREY----A--G 155 Torulaspora del...
XP_001643616  99 GDKGLVTYHEGSFAMIGRQLDSPIRF-EaK-DkLVLQYELKVQT-QFECGGAFIKLLPKVNE-S---DFKNY----G--D 165 Vanderwaltozyma...
XP_003686945 100 GDKSLVTYTDKGFGMIGTVFKKPIVMeD-G-DdLVIQYETKIQT-ALECGGAFIKLLPPIKK-S---QLKKY----GgeD 168 Tetrapisispora ...
XP_004181242  80 NKQCLAVIGVGSPAMIGHKLEHPIKM-DaN-EdLIVQYELKLQK-ELNCGGGFIKLYGHLNN-Kn--DLFQYrgqhS--K 151 Tetrapisispora ...
1JHN_A       139 -KTP--YTIMFGPDKC-G-EDYKLHFIFRHKNPKTGVYEEKHAKRP--D--AdlktYFT--DKKTHLYTLILN---PDN- 203 dog
Q6CET3       157 -ETP--YQIMFGPDKC-G-STNKVHFIVKRPLPD-GTYEEKHLVSP--A--H----ARL--NKLTNLYTLVIR---PKN- 216 Yarrowia lipoly...
XP_013933562 145 -DTP--YQVMFGPDKC-G-MSNKVHFIIRRKNPKTGEYEEKHLKVP--P--M----ARI--VKTSTLYTLIIK---PNQ- 205 Ogataea parapol...
XP_002491218 146 -ETP--YQVMFGPDKC-G-TTNKVHLIIKRKNPATGEYEEHQLATP--P--M----GRI--VKTTSLYTLIIK---PNN- 206 Komagataella pa...
XP_002495681 163 gSVP--FEVIFGPDKCqP-YTNEVHFGLKKTNPTTNKPEVKLLTNA--PisR----LDG--DETVRLYTLIMDs--KSQ- 228 Zygosaccharomyc...
XP_004177745 158 -TNPt-IELVFGPDKCiP-YTNEVHFGIKKTNPITNESEMKFLDKSvlP--N----FGR--DTLTHLYTLIVD---SNN- 222 Tetrapisispora ...
XP_003683274 156 -TSPi-LELLFGPDMC-PpYTDEIHLGIKKTNPYSMAPELKLLKEA--PlsS----LSD--TAIAHLYTLILK---GSTg 221 Torulaspora del...
XP_001643616 166 -DDSavLELLFGPDNCqP-YTDEIHFGIRKTNPISKKNDLMFLEHA--PvsK----LGD--DTLSHLYTLIIDg--KTN- 232 Vanderwaltozyma...
XP_003686945 169 -SPT--LELIFGPDNCaP-YTNEVHLGFRRHNPISNKTELVFFEKA--P--E----SRLgeDLKSHLYTLRLNg--KTQ- 233 Tetrapisispora ...
XP_004181242 152 -QMP--LQILFGPDKCiP-DINKVRFEMGKLNPKSGDMEIKQLVQS--PitQ----FGV--DFKTHLYTLILHnqgENQ- 218 Tetrapisispora ...
1JHN_A       204 S-FEILVDQSIVNSGNLLN--D--MTPPVNPSREIEDPEDQKPEDWDERPKIPDPDAV-KPDDWNEDAPAKIPDEEATKP 277 dog
Q6CET3       217 E-FEIRINGNVVKTGNLLE--EglFKPSFNPPAEIDDPEDTKPADWVEEPYMPDPEQAeKPADWDEKAPFYIADPEAVMP 293 Yarrowia lipoly...
XP_013933562 206 D-FEIRINGEVAKAGSLLD--SryFE--LTPPKEIDDPNDEKPADWVDDELIPDPNAV-KPEDWDEDAPYLIPDPDAVKP 279 Ogataea parapol...
XP_002491218 207 D-FEIRINGEVAKAGNLLN--EklIKPPFGAPKEIDDPEDQKPEDWVDEDMIPDPDAV-KPEDWDESEPLRIVDPEAVKP 282 Komagataella pa...
XP_002495681 229 D-FEIRVDGKVVKVGNLLD--EglFKPPFHAPKKVPDLKAKKPKNWDEREFIPDPEAI-KPEYWDESEPLMIPDDTDIKP 304 Zygosaccharomyc...
XP_004177745 223 DkYEIRIDGEVAIAGNFLDknS--FEPSLIPEQFIIDTTDTKPLDWDDRKQIPDPSIP-KPEGWDDRE--YITDTNAIKP 297 Tetrapisispora ...
XP_003683274 222 E-YEIRVDGSVTKAGRLLD--EgaFSPGFNPPKYIPDPNEEKPTEWDDLKLVPDPNVK-KPDDWNESEPLLIPDDIEEKP 297 Torulaspora del...
XP_001643616 233 D-FEIRYDGNVVIASNLLK--EgeFVPPFGGHKMIPNPKSVKPKDWDDRKVIPDYDQK-KPEDWDDRE--YIPDPDAKKP 306 Vanderwaltozyma...
XP_003686945 234 D-FELRFDGEVTFAANLLD--EgvFDPPFGGPKMIPDPNAVQPETWDDRKTIPDPSKT-KPKTWDDRA--VIPDPEAKKP 307 Tetrapisispora ...
XP_004181242 219 F-FEIRIDGKVVKYGNVFE--KgmFEPGFTGPRYIDDPNDFKPDNWVDEEYIDDPNDS-KPDDWDETEPYKIVDPDDFKP 294 Tetrapisispora ...
1JHN_A       278 DGWLDDEPEYVPDPDAEK-PEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKP 356 dog
Q6CET3       294 ADWQEDTPDYIVDPEAFK-PEDWDDEEDGEWVAPEIPNPVCE-EIGCGPWVAPKIQNPDYKGVWSQPMIENPDYKGTWAP 371 Yarrowia lipoly...
XP_013933562 280 EDWDEDAEAYIPDPDAVK-PEYWDEEEDGEWIAPKIPNPACEQ-HGCGPWSAPKIRNPDYKGKWTPELIENPDYKGPWSP 357 Ogataea parapol...
XP_002491218 283 ENWNEDAELYIPDPEATK-PEDWDDEEDGEWVAPVIPNPECADI-GCGPWKAPYITNPNYKGKWSPPLIENPDYKGPWSP 360 Komagataella pa...
XP_002495681 305 ASWDENMPEYIPEPNHFK-PKWWEDGEDGEWVAPLVRNPQCFEIAGCGPWQPRMVENPDYWGPWNPPMIENPKYRGKWTP 383 Zygosaccharomyc...
XP_004177745 298 SDWNEDLLPMIPDPTNPK-PEWWKDDVDGKWEPTMIRNPDCQNLSGCGPWEQPIIANPNYQGTW-ATLIDNPNYQGEWEP 375 Tetrapisispora ...
XP_003683274 298 ADWDESMPVIVPDSSRER-PEWWDDEHDGEWIAPMIENPACGEISGCGEWEPSLIDNPNYKGPWEPPLIENPNYQGVWQA 376 Torulaspora del...
XP_001643616 307 ESWDESIPEFISEPDRSQ-PSWWDEETDGEWVAPFIPNPLCKTEKGCGKWKPEYILNPDYQGQWKQPTKENPNYQGEWEP 385 Vanderwaltozyma...
XP_003686945 308 EKWDESIPKYIPDPERTKqPEWWNEEADGEWVAPLITNPSCDTEFGCGEWTAELISNPDYKGLWEQPMIENPDYMGVWEP 387 Tetrapisispora ...
XP_004181242 295 ADWDETIPEYIVDTKRPK-PEWWDDSIDGEWKPYMILNPECLKKKGCGKWKPKMKLNPKFKGVWQPRKILNPDYIGEWKP 373 Tetrapisispora ...
1JHN_A       357 RKIPNPDFFEDLEPFK-MTPFSAIGLELWSMTSDIFFDNFIV 397 dog
Q6CET3       372 KKIPNPNFKADEHA-SdLEPIGGLGFELWTMQEDILFDNIYV 412 Yarrowia lipolytica
XP_013933562 358 RKIPNPNYYEDPTP-SnLEPIGALGFELWTMTDSIMFDNIYL 398 Ogataea parapolymorpha DL-1
XP_002491218 361 KKIANPNYFEDKKP-AnLEPIGGLGFELWTMNADILFDNIYL 401 Komagataella pastoris GS115
XP_002495681 384 PLIDNPDYSEDLNPGTlENPIGVILFEFWSGSKDLLIDNLYL 425 Zygosaccharomyces rouxii CBS 732
XP_004177745 376 RKINNPEYYYEEHPGQiDNSIGALMLEFWSGSENLVFDNIYV 417 Tetrapisispora blattae CBS 6284
XP_003683274 377 KNIRNPNYFEDSAPAKlENKIGAIVFEFWSGTSNLLIDNIYI 418 Torulaspora delbrueckii
XP_001643616 386 ELIENPNHYEDKTPAKlENEIGSILFEFWSGSVDLMIDNIYL 427 Vanderwaltozyma polyspora DSM 70294
XP_003686945 388 ELIKNPEHYEDSTPSKlSEPVGGILFEFYSGSIDLLFDNIYV 429 Tetrapisispora phaffii CBS 4417
XP_004181242 374 QRILDPNSYEDITPCQvKDSIDGIVFDFVSGSNDMLIDNIYL 415 Tetrapisispora blattae CBS 6284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap