Conserved Protein Domain Family

pfam00413: Peptidase_M10 (this model, PSSM-Id:306839 is obsolete and has been replaced by 395334)
Click on image for an interactive view with Cn3D
The members of this family are enzymes that cleave peptides. These proteases require zinc for catalysis.
PSSM-Id: 306839
View PSSM: pfam00413
Aligned: 69 rows
Threshold Bit Score: 105.393
Threshold Setting Gi: 82100716
Created: 12-Jul-2016
Updated: 4-Aug-2016
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
1MMP_A  76 DGPGNTLAHAFAPGTGLGG-DAHFDEDERWTD--GS-------------------------------------------- 108 human
Q8AX63 184 EQKDGILGHEFP-GSGTGS-DSHFDDDEQWTL--GEaivlkikegniagegckfpfaiqgieyqsctegrdegwlecati 259 Amur catfish
O04529 231 DGVLGTLAHAFSP---PSG-KFHLDADENWVVsgDLdsf----------------------------------------- 265 thale cress
Q5XF51 235 DGPMRTLAHAFSP---PTG-HFHLDGEENWIVsgEGgdgf---------------------------------------- 270 thale cress
Q9ZR44 198 D----VVVSDFFI--NLRSfTIRLEASKVWD------------------------------------------------- 222 barrel medic
P29136 210 DGPGGILGHAFAP---TDG-RCHFDADEYWVAsgDVtks----------------------------------------- 244 soybean
Q9LEL9 234 DGVGGVLAHAYAP---TDG-RLHFDGDDAWSV--GAi------------------------------------------- 264 cucumber
Q8K3F2 242 DGSGQEFAHAWRL-----G-EIHFDDDEHFTP--LSs------------------------------------------- 270 house mouse
O93470 278 DGSGQEFAHAWFL-----G-DIHFDDDEHFTA--PSs------------------------------------------- 306 African clawed frog
Q23227 182 -----IAGSASKP---VNS-HIILDKNQEWAY--KSq------------------------------------------- 207 Caenorhabditis elegans
1MMP_A     --------------------------------------------------------------------------------     human
Q8AX63 260 ydfdengkysecpyeglftqginseggpcklpfifqaenydgcitsgrddgyrecaitenwdndksygfcpeiaasllgn 339 Amur catfish
O04529     --------------------------------------------------------------------------------     thale cress
Q5XF51     --------------------------------------------------------------------------------     thale cress
Q9ZR44     --------------------------------------------------------------------------------     barrel medic
P29136     --------------------------------------------------------------------------------     soybean
Q9LEL9     --------------------------------------------------------------------------------     cucumber
Q8K3F2     --------------------------------------------------------------------------------     house mouse
O93470     --------------------------------------------------------------------------------     African clawed frog
Q23227     --------------------------------------------------------------------------------     Caenorhabditis elegans
1MMP_A 109 --------------------------------------------SLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGn 144 human
Q8AX63 340 aeggpciiavellqqetessvqdgkeggkmcaiikeffddawglPQEASAFLVEAHEYAHLQGLAH--DPG--LTATYE- 414 Amur catfish
O04529 266 -----------------------------------------lsvTAAVDLESVAVHEIGHLLGLGHSSVEESIMYPTITt 304 thale cress
Q5XF51 271 -----------------------------------------isvSEAVDLESVAVHEIGHLLGLGHSSVEGSIMYPTIRt 309 thale cress
Q9ZR44 223 -------------------------------------------------LETVAMHQIGHLLGLDHSSDVESIMYPTIVp 253 barrel medic
P29136 245 ------------------------------------------pvTSAFDLESVAVHEIGHLLGLGHSSDLRAIMYPSIPp 282 soybean
Q9LEL9 265 --------------------------------------------SGYFDVETVALHEIGHILGLQHSTIEEAIMFPSIP- 299 cucumber
Q8K3F2 271 --------------------------------------------DTGISLLKVAVHEIGHVLGLPHTYRVGSIMQPNYIp 306 house mouse
O93470 307 --------------------------------------------EHGISLLKVAAHEIGHVLGLSHIHRVGSIMQPNYIp 342 African clawed frog
Q23227 208 -------------------------------------------aPMGISLYHTLLHEIGHILGLPHTFYRGSIMHPIFKp 244 Caenorhabditis elegans
1MMP_A 145 --gDpqNF-KLSQDDIKGIQKLYG 165 human
Q8AX63 415 ---MapEN-RIDNDDIKGIQELYA 434 Amur catfish
O04529 305 ---GkrKV-DLTNDDVEGIQYLYG 324 thale cress
Q5XF51 310 ---GrrKV-DLTTDDVEGVQYLYG 329 thale cress
Q9ZR44 254 --lHqkKV-QITVSDNQAIQQLYT 274 barrel medic
P29136 283 ---RtrKV-NLAQDDIDGIRKLYG 302 soybean
Q9LEL9 300 ---EgvTK-GLHGDDIAGIKALYR 319 cucumber
Q8K3F2 307 ---QepAF-ELDWADRKAIQRLYG 326 house mouse
O93470 343 ---QdsGF-ELDLSDRRAIQNLYG 362 African clawed frog
Q23227 245 vllPhgTVdTVPNVDRLAIRKIYG 268 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap