2INY


Conserved Protein Domain Family
Adeno_hexon

?
pfam01065: Adeno_hexon (this model, PSSM-Id:307283 is obsolete and has been replaced by 334369)
Click on image for an interactive view with Cn3D
Hexon, adenovirus major coat protein, N-terminal domain
Hexon is the major coat protein from adenovirus type 2. Hexon forms a homo-trimer. The 240 copies of the hexon trimer are organised so that 12 lie on each of the 20 facets. The central 9 hexons in a facet are cemented together by 12 copies of polypeptide IX. The penton complex, formed by the peripentonal hexons and base hexon (holding in place a fibre), lie at each of the 12 vertices. The N and C-terminal domains adopt the same PNGase F-like fold although they are significantly different in length.
Statistics
?
PSSM-Id: 307283
View PSSM: pfam01065
Aligned: 3 rows
Threshold Bit Score: 814.552
Threshold Setting Gi: 81971576
Created: 13-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2INY_A       50 FRQTVVAPTRNVTTEKAQRLQIRFYPIQTDDTPNSYRVRYSVNVGDSWVLDMGATYFDIKGVLDRGPSFKPYGGTAYNPL 129
gi 81971576  45 FRETIVAPTKGVTSEQSQRLQVRIIPVQTQDAEQTYTARFTIAVGEGRVLDMGSTYFDIRGIVDRGPSFKPYSGTAYNSL 124
gi 81993039  40 FRDPFVAPSTGVTTDRSQKLQLRIVPIQTEDNENFYKTRFTLNVGDNRVADLGSAYFDIEGVIDRGPTFKPYGGTAYNPL 119
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2INY_A      130 APREAIFNTW--VESTGPQTNVV-GQMTNVYt-NQTRNDKTATLQQVNsiSGVVPNVNLGpGLSQLASrad-vdNIGVVG 204
gi 81971576 125 APKSAVFNNVktVSIGGTNTSVLtAQAPHLYsiNTGDNGCTAATTTAAtfSGTVPNPGGGdIEQTFSS------NEGGAG 198
gi 81993039 120 APKSAFPNAA--FMDTDEATTIYiAQLPNAY--NAQNKGVEEAIRVEA--NTTTPNPQSG-EYATYDSakfnpeTTGASG 192
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2INY_A      205 RFAKVDS-AGVkqaYGAYVKPVKDDGSQSL--------NQTAYwlmdngGTNYLGALAVEdyTQTLSYPDTVLVtppTAY 275
gi 81971576 199 RVVNAQQdTGV---YGAYAQPVNEAGNQNTaavtskftNAGKGg-----NVTCTSAFAVE--TVGLTYPDTRVV---AYD 265
gi 81993039 193 RLLGINSlGDLfpaYGSYCRPQSADGNISTapitkvylNTTAT------DDRVSGVTAVD--TATRLHPDAHYI---EYT 261
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2INY_A      276 QQvNSGTMRACRPNYIGFRDNFINLLYHDSGVCSGTLNSERSGMNVVVELQDRNTELSYQYMLADMMSRHHYFALWNQAV 355
gi 81971576 266 DDtGDVTRLGNRINYIGFRDNFVGLMYYDNGAHSGTLATETGDINIVEPLQDRNTEISYQYMLADLMSRHHYFAMWNQAV 345
gi 81993039 262 DE-AKATAIGNRPNYIGFRDNFIGLMFYNNGSNAGTFSSQTQQLNVVLDLNDRNSELSYQYLIADLTDRYRYFALWNQAV 340
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2INY_A      356 DQYDHDVRVFNNDGYEEGVPTYAFLPDGHGaGEdNGPDLSNVKIYTNGqqDKGNVVAGtVSTQLNFGTIPSYEIDIAAAT 435
gi 81971576 346 DDYELGVRVLSNHGYEEAMPALSFNTTGMG-NYgGAALLSGQQVTINS--NAATAVAN-SKALIGFGAVPSMEMNLGAQL 421
gi 81993039 341 DSYDQYVRILHNEGYEEAPPALSFPSQGIQ-NY-FMPTAAGNAMTVDTgrNTAAKTDN-TKAFIGYGNMPSLEMNLTANL 417
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2INY_A      436 RRNFIMSNIADYLPDKYKFSirgfdpvtDNI---------DPTTYFYMNRRVPLTNVVDLFTNIGARWSVDQMDNVNPFN 506
gi 81971576 422 ARSWLFANVAEYMPDDLKVS--------VNVpqrypqpgtNTSSYNYKNLRLPNVNLIDLFTQIGGRYSLSFMDNVNPFN 493
gi 81993039 418 QRTFLWSNVAMYLPDRLKTTpp-----nINLp-------dDTNSYGYINGRVPLANIIDTWTNIGARWSLDVMDTVNPFN 485
                       490       500       510       520
                ....*....|....*....|....*....|....*....|.
2INY_A      507 HHRNWGLKYRSQLLGNSRYCRFHIQVPQKYFAIKNLLLLPG 547
gi 81971576 494 HHKNRGLKYRSELLGNGRIAKFHIQVPQKFFAIKKLLLLPG 534
gi 81993039 486 HHRNSGLKYRSQLLGNGRYCRFHIQVPQKFFPIKNLLLLPG 526
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap