3W1K


Conserved Protein Domain Family
SelA

?
pfam03841: SelA 
Click on image for an interactive view with Cn3D
L-seryl-tRNA selenium transferase
Statistics
?
PSSM-Id: 309101
Aligned: 10 rows
Threshold Bit Score: 571.206
Threshold Setting Gi: 15214285
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3W1K_A        72 VINATGVVINTNLGRAPLSKDVINFISEIANGYSNLEYNLEEGKRGSRIAHIEKYLNELTGAESSFVVNNNAGAVFLVLN 151 Aquifex aeolicu...
Q2RFK3        80 VINATGVVLHTNLGRAILSPAARAAALTAAGRYTNLEYDLEKGQRGNRYSHVTGLLKELTGAEEALVVNNNAAAVLLALS 159 Moorella thermo...
P58226        80 LFNLTGTVLHTNLGRALLAQEAVDAAVDAMREAAALEFDLDSGGRGERDSHLRELLCELTGAEDATVVNNNAAAVLIALN 159 Sinorhizobium m...
P0A821        83 VINLTGTVLHTNLGRALQAEAAVEAVAQAMRSPVTLEYDLDDAGRGHRDRALAQLLCRITGAEDACIVNNNAAAVLLMLA 162 Escherichia col...
Q9CK66        81 VHNLTGTILHTNLGRALWSDAAQHAALTSMSHNVALEYDLEEGKRSHRDHYISDLLCQLTGAEAACIVNNNAAAVLLMLA 160 Pasteurella mul...
P43910        82 VHNLTGTVLHTNLGRALWSEAAQQAALSAMQKNVSLEYDLDEGKRSHRDNYISELLCKLTGAEAACIVNNNAAAVLLMLA 161 Haemophilus inf...
WP_012805713  82 VINATGVVIHTNLGRSILAEEAAAAVAQGCRHYSNLEMDLDTGQRGSRYAHVEKLLCRLTGAEAGLVVNNNAAAVLLVLD 161 Desulfomicrobiu...
WP_025435479  86 LINATGVVVHTNLGRSPMAEEIKEDLWLIASRYSNLEYDIESGKRGSRYSHLEEIVRKITGAEDVLVVNNNAAAVMLVLG 165 Peptoclostridiu...
Q9PMS2        71 VINASGVVIHTNLGRSVIHEELYEACKDIICNYSNVEFDLENGKRGSRYALVLEKLKMLFECEDALVVNNNAAAVFLVLN 150 Campylobacter j...
Q9HV01        79 VFNLTGTVLHTNLGRALLPDEAIEAITLAARYPLNLEFDLASGKRGDRDDLIAGLIRELTGAEAVTVVNNNAAAVLLALN 158 Pseudomonas aer...
3W1K_A       152 TLAEGKEVIISRGELVEIGGSFRIPDIMKKSGAILREVGTTNKTKVSDYEGAINQNTALLMKVHKSNFYMEGFVEEVKLE 231 Aquifex aeolicu...
Q2RFK3       160 TLAAGRETIISRGQLVEIGGSFRIPEVMGQSGTRLVEVGTTNKTYIHDYERAVGPDTALLLKVHPSNYRIQGFTREVTTA 239 Moorella thermo...
P58226       160 SVGAGRQAIVSRGELIEIGGAFRMPDIMERAGVDLVEVGTTNRTHAKDYVKAIGPETALILKVHTSNYRIEGFTAEVPGA 239 Sinorhizobium m...
P0A821       163 ATASGKEVVVSRGELVEIGGAFRIPDVMRQAGCTLHEVGTTNRTHANDYRQAVNENTALLMKVHTSNYSIQGFTKAIDEA 242 Escherichia col...
Q9CK66       161 TFAQGKEVIISRGELIEIGGAFRIPDIMQQAGCKLVEVGTTNRTHLSDYRHAINENTAFLMKVHSSNYQICGFTKSVTEA 240 Pasteurella mul...
P43910       162 TFAQGKEVIISRGELIEIGGAFRIPDIMEQAGCHLVEVGTTNRTHLKDYRNAITENTAFLMKVHSSNYQICGFTSSVSEE 241 Haemophilus inf...
WP_012805713 162 TLAKGREVVVSRGQLVEIGGSFRIPEVMKKSGAVLREVGATNRTHLRDYSEAIGADTAMLMKVHTSNYRIIGFHKEVELP 241 Desulfomicrobiu...
WP_025435479 166 TMAQGKEVITSRGELVEIGGSFRIPSVMEQSGAKLVEVGTTNKTYASDYEAAITENTGALLKVHTSNFRVVGFTNTPELE 245 Peptoclostridiu...
Q9PMS2       151 SLCYDKEVISSRGELVEIGGSFRVPEVIKAAGVKLCEVGTSNKTHLKDYEQAINENTALILKTHKSNFALMGFHSEVNIK 230 Campylobacter j...
Q9HV01       159 SLGARKEGIISRGELIEIGGAFRIPDIMARAGVRLHEVGTTNRTHAKDYEAAIGPRSGLLMRVHTSNYSVQGFTASVPTA 238 Pseudomonas aer...
3W1K_A       232 DLVKLGHKYGIPTYYDAGSGLLINLKEFGISVdEPNFRDCISLGIDLVSGSGDXLLGGPQAGIIVGKKNLIEKIKKNPIA 311 Aquifex aeolicu...
Q2RFK3       240 ELVELGRRVGVPVMEDLGSGFLIDLEAYGITG-EPTVQAEINQGVDVVTFSGDKLLGGPQAGIIVGRRDLVAAMAGHPLT 318 Moorella thermo...
P58226       240 ELAAIAHERGVVLLNDLGSGSLVDLSRYGLGR-EPTVREAVAEGADLVTFSGDKLLGGPQAGFIVGRRDLIAEINRNPLK 318 Sinorhizobium m...
P0A821       243 ELVALGKELDVPVVTDLGSGSLVDLSQYGLPK-EPMPQELIAAGVSLVSFSGDKLLGGPQAGIIVGKKEMIARLQSHPLK 321 Escherichia col...
Q9CK66       241 ELVTLAREFNLPVMTDLGSGALVDLAQYGLPK-EPTVQEKWAQGVELISFSGDKLLGGPQAGIIVGKKAWIDRLQTHPLK 319 Pasteurella mul...
P43910       242 ELTELGQEMNVPVVTDLGSGALVDLSQYGLPK-EPTVQEKIAQGVDLVSFSGDKLLGGVQAGIIVGKKEWIEQLQAHPLK 320 Haemophilus inf...
WP_012805713 242 ELVALGREKGLSTFEDLGSGNLFDFSPYGFMP-EPTVQQVLKSGVDVVTFSGDKLLGGPQAGVIVGRREYIERIKKNQLN 320 Desulfomicrobiu...
WP_025435479 246 ELREIGDKYDIPVIEDLGSGVFIDLSKYGLSY-EPTVMDSLRKGADIVTFSGDKILGGPQAGIIVGKKKYIDKMKKNQLT 324 Peptoclostridiu...
Q9PMS2       231 DLHELAKEKELLSYYDLGSGWCENLNEKLIKN-EPKIRKLVQE-CDILSFSGDKLFGSVQAGIILGKKELIEKLKQNQLL 308 Campylobacter j...
Q9HV01       239 QLAAIAHGHGLPLLEDLGSGTLVDLTRWGLPK-EPTVQEALADGADIVTFSGDKLLGGPQAGLILGNRELIGRIKKNPLK 317 Pseudomonas aer...
3W1K_A       312 RALRIDKLTLSGLEMTLKLYF--EKRYEDIPVIRMLTQDEKALRQKAKRLEKLLKDIPG---LKISVIKDKAKPGGGSLP 386 Aquifex aeolicu...
Q2RFK3       319 RALRIDKMNLAALEATLRAYRnpDRAVKEIPTLAALVALPEDLRLRAEELQKLLTSVLGs-rARVGLMPTTSQAGGGSLP 397 Moorella thermo...
P58226       319 RALRVDKIRIAATAATLKLYRdpDRLASRLPTLFMLSRVQAEVRAQAERLAPQVGAMLApsgYAVEVCSCSSQIGSGALP 398 Sinorhizobium m...
P0A821       322 RALRADKMTLAALEATLRLYLhpEALSEKLPTLRLLTRSAEVIQIQAQRLQAPLAAHYGa-eFAVQVMPCLSQIGSGSLP 400 Escherichia col...
Q9CK66       320 RALRCDKVILAGLEATLRLYLqpEKLSQHLTTLRLLTQPVEALHEQAEQLQSVLLTKLTt-dYSVAITNSVAQIGSGSQP 398 Pasteurella mul...
P43910       321 RVLRCDKVILAGLEATLRLYLnpEKLTEKLPTLRLLTQPLKQLKINAMRLKERLESRLNs-qFELQIEASQAQIGSGSQP 399 Haemophilus inf...
WP_012805713 321 RALRIDKMTLAALEATLRLYLdpEQARRTVPTLAMITAGPEELRARAGRLRRRLSRALAg-lAAVTVKSGFSRVGGGSFP 399 Desulfomicrobiu...
WP_025435479 325 RALRVDKFIICALEATMRYYIeeEIAIKKIPTLRMLTYKLDEIKEKAQRLN-EMIGRLGi-pAEVKIEVGHSQVGGGSLP 402 Peptoclostridiu...
Q9PMS2       309 RMLRVDKLTLSFLNESLKAYL--QKDYEKIITLKLLNDDLSFIEKKALRVQKELKFQTQ-----LKKSKS--LVGGGSMP 379 Campylobacter j...
Q9HV01       318 RALRVDKLTLAALEAVLGLYRdpDRLAERLTTLRLLSRPAAEIRAQAERLAPALGEALGe-gWEVAVVDALGMIGSGAQP 396 Pseudomonas aer...
3W1K_A       387 ELELPTYCVAIRHDRL------SSQELSRRLRLAEPPIVCRIREDQLLFDMRTV 434 Aquifex aeolicus VF5
Q2RFK3       398 VTELPSWAITIRPEQG------GAAGLVTALRRTDPPVLARVQDDLLLLDVRTL 445 Moorella thermoacetica ATCC 39073
P58226       399 VDTIPSAGLRIVG-SSg----sALEALAALFRSLSRPILGRLRDGALVLDLRCL 447 Sinorhizobium meliloti 1021
P0A821       401 VDRLPSAALTFTPHDGrg---sHLESLAARWRELPVPVIGRIYDGRLWLDLRCL 451 Escherichia coli K-12
Q9CK66       399 MATIPSVAVTISTEKAg-----KLTALLQRFKALPQPIICRVEKEKIWLDLRGL 447 Pasteurella multocida subsp. multocida st...
P43910       400 MERIPSVAVTIAEKTNa-----KLSALSARFKQLSQPIIGRMENGKIWLDLRSL 448 Haemophilus influenzae Rd KW20
WP_012805713 400 EQDLPTTLVSVAPAGM------DVESLRQGLLAADIPVVGRMEDGAFCLDPRTL 447 Desulfomicrobium baculatum
WP_025435479 403 LERIESRVISIVPENM------SVSRLEESLRLCDDHIIGRVYDEKYVIDVRTL 450 Peptoclostridium acidaminophilum
Q9PMS2       380 DKSLDTYILTFQG-----------DALKLQTRFRKENIIGRIENDEFVLDFRTI 422 Campylobacter jejuni subsp. jejuni NCTC 1...
Q9HV01       397 VARLASAALCLRPRQPrrlrgrALRNLEEALRGLPLPVIGRLDDDALWLDLRQL 450 Pseudomonas aeruginosa PAO1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap